Not a member of Pastebin yet?
Sign Up,
it unlocks many cool features!
- maasha@cletus:~/maasha_install/lib/ruby/gems/1.9.1/gems/bioruby-0.6.4/lib/bio$ cat sequence.rb
- #
- # bio/sequence.rb - biological sequence class
- #
- # Copyright (C) 2000-2005 KATAYAMA Toshiaki <[email protected]>
- # Copyright (C) 2001 Yoshinori K. Okuji <[email protected]>
- # Copyright (C) 2003 GOTO Naohisa <[email protected]>
- #
- # This library is free software; you can redistribute it and/or
- # modify it under the terms of the GNU Lesser General Public
- # License as published by the Free Software Foundation; either
- # version 2 of the License, or (at your option) any later version.
- #
- # This library is distributed in the hope that it will be useful,
- # but WITHOUT ANY WARRANTY; without even the implied warranty of
- # MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
- # Lesser General Public License for more details.
- #
- # You should have received a copy of the GNU Lesser General Public
- # License along with this library; if not, write to the Free Software
- # Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
- #
- # $Id: sequence.rb,v 0.40 2005/08/10 12:53:02 k Exp $
- #
- require 'bio/data/na'
- require 'bio/data/aa'
- require 'bio/data/codontable'
- require 'bio/location'
- module Bio
- # Nucleic/Amino Acid sequence
- class Sequence < String
- def to_s
- "%s" % self
- end
- alias :to_str :to_s
- def seq
- self.class.new(self)
- end
- def normalize!
- initialize(self)
- self
- end
- alias :seq! :normalize!
- def <<(*arg)
- super(self.class.new(*arg))
- end
- alias :concat :<<
- def +(*arg)
- self.class.new(super(*arg))
- end
- def subseq(s = 1, e = self.length)
- return nil if s < 1 or e < 1
- s -= 1
- e -= 1
- self[s..e]
- end
- def to_fasta(header = '', width = nil)
- ">#{header}\n" +
- if width
- self.to_s.gsub(Regexp.new(".{1,#{width}}"), "\\0\n")
- else
- self.to_s + "\n"
- end
- end
- def fasta(factory, header = nil)
- factory.query(self.to_fasta(header))
- end
- def blast(factory, header = nil)
- factory.query(self.to_fasta(header))
- end
- def window_search(window_size, step_size = 1)
- i = 0
- 0.step(self.length - window_size, step_size) do |i|
- yield self[i, window_size]
- end
- return self[i + window_size .. -1]
- end
- def total(hash)
- hash.default = 0.0 unless hash.default
- sum = 0.0
- self.each_byte do |x|
- begin
- sum += hash[x.chr]
- end
- end
- return sum
- end
- def composition
- count = Hash.new(0)
- self.scan(/./) do |x|
- count[x] += 1
- end
- return count
- end
- def randomize(hash = nil)
- length = self.length
- if hash
- count = hash.clone
- count.each_value {|x| length += x}
- else
- count = self.composition
- end
- seq = ''
- tmp = {}
- length.times do
- count.each do |k, v|
- tmp[k] = v * rand
- end
- max = tmp.max {|a, b| a[1] <=> b[1]}
- count[max.first] -= 1
- if block_given?
- yield max.first
- else
- seq += max.first
- end
- end
- return self.class.new(seq)
- end
- def self.randomize(*arg, &block)
- self.new('').randomize(*arg, &block)
- end
- # This method depends on Locations class, see bio/location.rb
- def splicing(position)
- unless position.is_a?(Locations) then
- position = Locations.new(position)
- end
- s = ''
- position.each do |location|
- if location.sequence
- s << location.sequence
- else
- exon = self.subseq(location.from, location.to)
- begin
- exon.complement! if location.strand < 0
- rescue NameError
- end
- s << exon
- end
- end
- return self.class.new(s)
- end
- # Nucleic Acid sequence
- class NA < Sequence
- def initialize(str)
- super
- self.downcase!
- self.tr!(" \t\n\r",'')
- end
- # This method depends on Locations class, see bio/location.rb
- def splicing(position)
- mRNA = super
- if mRNA.rna?
- mRNA.tr!('t', 'u')
- else
- mRNA.tr!('u', 't')
- end
- mRNA
- end
- def complement
- s = self.class.new(self)
- s.complement!
- s
- end
- def complement!
- if self.rna?
- self.reverse!
- self.tr!('augcrymkdhvbswn', 'uacgyrkmhdbvswn')
- else
- self.reverse!
- self.tr!('atgcrymkdhvbswn', 'tacgyrkmhdbvswn')
- end
- self
- end
- def translate(frame = 1, table = 1, unknown = 'X')
- if table.is_a?(Bio::CodonTable)
- ct = table
- else
- ct = Bio::CodonTable[table]
- end
- naseq = self.dna
- case frame
- when 1, 2, 3
- frame -= 1
- when 4, 5, 6
- frame -= 4
- naseq.complement!
- when -1, -2, -3
- frame = -1 - frame
- naseq.complement!
- else
- frame = 0
- end
- nalen = naseq.length - (naseq.length - frame) % 3
- aaseq = naseq[frame, nalen].gsub(/.{3}/) {|codon| ct[codon] or unknown}
- return Bio::Sequence::AA.new(aaseq)
- end
- def gc_percent
- count = self.composition
- at = count['a'] + count['t'] + count['u']
- gc = count['g'] + count['c']
- gc = format("%.1f", gc.to_f / (at + gc) * 100)
- return gc.to_f
- end
- alias :gc :gc_percent
- def illegal_bases
- self.scan(/[^atgcu]/).sort.uniq
- end
- # NucleicAcid is defined in bio/data/na.rb
- def molecular_weight
- if self.rna?
- NucleicAcid.weight(self, true)
- else
- NucleicAcid.weight(self)
- end
- end
- def to_re
- if self.rna?
- NucleicAcid.to_re(self.dna, true)
- else
- NucleicAcid.to_re(self)
- end
- end
- def names
- array = []
- self.each_byte do |x|
- array.push(NucleicAcid.names[x.chr.upcase])
- end
- return array
- end
- def dna
- self.tr('u', 't')
- end
- def dna!
- self.tr!('u', 't')
- end
- def rna
- self.tr('t', 'u')
- end
- def rna!
- self.tr!('t', 'u')
- end
- def rna?
- self.index('u')
- end
- protected :rna?
- def pikachu
- self.dna.tr("atgc", "pika") # joke, of course :-)
- end
- end
- # Amino Acid sequence
- class AA < Sequence
- def initialize(str)
- super
- self.upcase!
- self.tr!(" \t\n\r",'')
- end
- # AminoAcid is defined in bio/data/aa.rb
- def molecular_weight
- AminoAcid.weight(self)
- end
- def to_re
- AminoAcid.to_re(self)
- end
- def codes
- array = []
- self.each_byte do |x|
- array.push(AminoAcid.names[x.chr])
- end
- return array
- end
- def names
- self.codes.map do |x|
- AminoAcid.names[x]
- end
- end
- end
- end
- class Seq < Sequence
- attr_accessor :entry_id, :definition, :features, :references, :comments,
- :date, :keywords, :dblinks, :taxonomy, :moltype
- end
- end
- if __FILE__ == $0
- puts "== Test Bio::Sequence::NA.new"
- p Bio::Sequence::NA.new('')
- p na = Bio::Sequence::NA.new('atgcatgcATGCATGCAAAA')
- p rna = Bio::Sequence::NA.new('augcaugcaugcaugcaaaa')
- puts "\n== Test Bio::Sequence::AA.new"
- p Bio::Sequence::AA.new('')
- p aa = Bio::Sequence::AA.new('ACDEFGHIKLMNPQRSTVWYU')
- puts "\n== Test Bio::Sequence#to_s"
- p na.to_s
- p aa.to_s
- puts "\n== Test Bio::Sequence#subseq(2,6)"
- p na
- p na.subseq(2,6)
- puts "\n== Test Bio::Sequence#[2,6]"
- p na
- p na[2,6]
- puts "\n== Test Bio::Sequence#to_fasta('hoge', 8)"
- puts na.to_fasta('hoge', 8)
- puts "\n== Test Bio::Sequence#window_search(15)"
- p na
- na.window_search(15) {|x| p x}
- puts "\n== Test Bio::Sequence#total({'a'=>0.1,'t'=>0.2,'g'=>0.3,'c'=>0.4})"
- p na.total({'a'=>0.1,'t'=>0.2,'g'=>0.3,'c'=>0.4})
- puts "\n== Test Bio::Sequence#composition"
- p na
- p na.composition
- p rna
- p rna.composition
- puts "\n== Test Bio::Sequence::NA#splicing('complement(join(1..5,16..20))')"
- p na
- p na.splicing("complement(join(1..5,16..20))")
- p rna
- p rna.splicing("complement(join(1..5,16..20))")
- puts "\n== Test Bio::Sequence::NA#complement"
- p na.complement
- p rna.complement
- p Bio::Sequence::NA.new('tacgyrkmhdbvswn').complement
- p Bio::Sequence::NA.new('uacgyrkmhdbvswn').complement
- puts "\n== Test Bio::Sequence::NA#translate"
- p na
- p na.translate
- p rna
- p rna.translate
- puts "\n== Test Bio::Sequence::NA#gc_percent"
- p na.gc
- p rna.gc
- puts "\n== Test Bio::Sequence::NA#illegal_bases"
- p na.illegal_bases
- p Bio::Sequence::NA.new('tacgyrkmhdbvswn').illegal_bases
- p Bio::Sequence::NA.new('abcdefghijklmnopqrstuvwxyz-!%#$@').illegal_bases
- puts "\n== Test Bio::Sequence::NA#molecular_weight"
- p na
- p na.molecular_weight
- p rna
- p rna.molecular_weight
- puts "\n== Test Bio::Sequence::NA#to_re"
- p Bio::Sequence::NA.new('atgcrymkdhvbswn')
- p Bio::Sequence::NA.new('atgcrymkdhvbswn').to_re
- p Bio::Sequence::NA.new('augcrymkdhvbswn')
- p Bio::Sequence::NA.new('augcrymkdhvbswn').to_re
- puts "\n== Test Bio::Sequence::NA#names"
- p na.names
- puts "\n== Test Bio::Sequence::NA#pikachu"
- p na.pikachu
- puts "\n== Test Bio::Sequence::NA#randomize"
- print "Orig : "; p na
- print "Rand : "; p na.randomize
- print "Rand : "; p na.randomize
- print "Rand : "; p na.randomize.randomize
- print "Block : "; na.randomize do |x| print x end; puts
- print "Orig : "; p rna
- print "Rand : "; p rna.randomize
- print "Rand : "; p rna.randomize
- print "Rand : "; p rna.randomize.randomize
- print "Block : "; rna.randomize do |x| print x end; puts
- puts "\n== Test Bio::Sequence::NA.randomize(counts)"
- print "Count : "; p counts = {'a'=>10,'c'=>20,'g'=>30,'t'=>40}
- print "Rand : "; p Bio::Sequence::NA.randomize(counts)
- print "Count : "; p counts = {'a'=>10,'c'=>20,'g'=>30,'u'=>40}
- print "Rand : "; p Bio::Sequence::NA.randomize(counts)
- print "Block : "; Bio::Sequence::NA.randomize(counts) {|x| print x}; puts
- puts "\n== Test Bio::Sequence::AA#codes"
- p aa
- p aa.codes
- puts "\n== Test Bio::Sequence::AA#names"
- p aa
- p aa.names
- puts "\n== Test Bio::Sequence::AA#molecular_weight"
- p aa.subseq(1,20)
- p aa.subseq(1,20).molecular_weight
- puts "\n== Test Bio::Sequence::AA#randomize"
- aaseq = 'MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA'
- s = Bio::Sequence::AA.new(aaseq)
- print "Orig : "; p s
- print "Rand : "; p s.randomize
- print "Rand : "; p s.randomize
- print "Rand : "; p s.randomize.randomize
- print "Block : "; s.randomize {|x| print x}; puts
- puts "\n== Test Bio::Sequence::AA.randomize(counts)"
- print "Count : "; p counts = s.composition
- print "Rand : "; puts Bio::Sequence::AA.randomize(counts)
- print "Block : "; Bio::Sequence::AA.randomize(counts) {|x| print x}; puts
- end
- =begin
- = Bio::Sequence
- You can use Bio::Seq instead of Bio::Sequence for short.
- --- Bio::Sequence#seq
- Force self to re-initialize for clean up (remove white spaces,
- case unification).
- --- Bio::Sequence#seq!
- --- Bio::Sequence#normalize!
- Similar to the 'seq' method, but changes the self object destructively.
- --- Bio::Sequence#subseq(start = 1, end = self.length)
- Returns the subsequence of the self string.
- --- Bio::Sequence#to_fasta(header = '', width = nil)
- Output the FASTA format string of the sequence. The 1st argument is
- used as the comment string. If the 2nd option is given, the output
- sequence will be folded.
- --- Bio::Sequence#fasta(factory, header = '')
- Execute fasta by the factory (Bio::Fasta object) and returns
- Bio::Fasta::Report object. See Bio::Fasta for more details.
- --- Bio::Sequence#blast(factory, header = '')
- Execute blast by the factory (Bio::Blast object) and returns
- Bio::Blast::Report object. See Bio::Blast for more details.
- --- Bio::Sequence#splicing(position)
- Receive a GenBank style position string and convert it to the Locations
- objects to splice the sequence itself. See also: bio/location.rb
- --- Bio::Sequence#window_search(window_size, step_size = 1)
- This method iterates on sub string with specified length 'window_size'.
- By specifing 'step_size', codon sized shifting or spliting genome
- sequence with ovelapping each end can easily be yielded.
- The remainder sequence at the terminal end will be returned.
- Example:
- # prints average GC% on each 100bp
- seq.window_search(100) do |subseq|
- puts subseq.gc
- end
- # prints every translated peptide (length 5aa) in the same frame
- seq.window_search(15, 3) do |subseq|
- puts subseq.translate
- end
- # split genome sequence by 10000bp with 1000bp overlap in fasta format
- i = 1
- remainder = seq.window_search(10000, 9000) do |subseq|
- puts subseq.to_fasta("segment #{i}", 60)
- i += 1
- end
- puts remainder.to_fasta("segment #{i}", 60)
- --- Bio::Sequence#total(hash)
- This method receive a hash of residues/bases to the particular values,
- and sum up the value along with the self sequence. Especially useful
- to use with the window_search method and amino acid indices etc.
- --- Bio::Sequence#composition
- Returns a hash of the occurrence counts for each residue or base.
- --- Bio::Sequence#randomize(count = nil)
- Returns a randomized sequence keeping its composition by default.
- The argument is required when generating a random sequence from the empty
- sequence (used by the class methods NA.randomize, AA.randomize).
- If the block is given, yields for each random residue/base.
- --- Bio::Sequence.randomize(composition)
- Generate a new random sequence with the given frequency of bases
- or residues. The sequence length is determined by the sum of each
- base/residue occurences.
- == Bio::Sequence::NA
- --- Bio::Sequence::NA.new(str)
- Generate a nucleic acid sequence object from a string.
- --- Bio::Sequence::NA#complement
- --- Bio::Sequence::NA#complement!
- Returns a reverse complement sequence (including the universal codes).
- --- Bio::Sequence::NA#translate(frame = 1, table = 1, unknown = 'X')
- Translate into the amino acid sequence from the given frame and the
- selected codon table. The table also can be a Bio::CodonTable object.
- The 'unknown' character is used for invalid/unknown codon (can be
- used for 'nnn' and/or gap translation in practice).
- Frame can be 1, 2 or 3 for the forward strand and -1, -2 or -3
- (4, 5 or 6 is also accepted) for the reverse strand.
- --- Bio::Sequence::NA#gc_percent
- --- Bio::Sequence::NA#gc
- Calculate the ratio of GC / ATGC bases in percent.
- --- Bio::Sequence::NA#illegal_bases
- Show abnormal bases other than 'atgcu'.
- --- Bio::Sequence::NA#molecular_weight
- Estimate the weight of this biological string molecule.
- --- Bio::Sequence::NA#to_re
- Convert the universal code string into the regular expression.
- --- Bio::Sequence::NA#names
- Convert the self string into the list of the names of the each base.
- --- Bio::Sequence::NA#dna
- --- Bio::Sequence::NA#dna!
- Output a DNA string by substituting 'u' to 't'.
- --- Bio::Sequence::NA#rna
- --- Bio::Sequence::NA#rna!
- Output a RNA string by substituting 't' to 'u'.
- == Bio::Sequence::AA
- --- Bio::Sequence::AA.new(str)
- Generate a amino acid sequence object from a string.
- --- Bio::Sequence::AA#codes
- Generate the list of the names of the each residue along with the
- sequence (3 letters code).
- --- Bio::Sequence::NA#names
- Similar to codes but returns long names.
- --- Bio::Sequence::AA#molecular_weight
- Estimate the weight of this protein.
- =end
- maasha@cletus:~/maasha_install/lib/ruby/gems/1.9.1/gems/bioruby-0.6.4/lib/bio$
Add Comment
Please, Sign In to add comment