Guest User

syslog - Hard-Reset - FB funzt

a guest
Oct 27th, 2019
82
Never
Not a member of Pastebin yet? Sign Up, it unlocks many cool features!
  1. Oct 27 20:17:43 localhost epgd: EPG Update started
  2. Oct 27 20:17:43 localhost epgd: Updating 'tvm' day today+0 now
  3. Oct 27 20:17:43 localhost epgd: Checking tvm id 1
  4. Oct 27 20:18:09 localhost systemd-modules-load[384]: Inserted module 'iscsi_tcp'
  5. Oct 27 20:18:09 localhost systemd-modules-load[384]: Inserted module 'ib_iser'
  6. Oct 27 20:18:09 localhost systemd[1]: Mounted FUSE Control File System.
  7. Oct 27 20:18:09 localhost systemd[1]: Mounted Kernel Configuration File System.
  8. Oct 27 20:18:09 localhost systemd[1]: Starting Flush Journal to Persistent Storage...
  9. Oct 27 20:18:09 localhost blkmapd[424]: open pipe file /run/rpc_pipefs/nfs/blocklayout failed: No such file or directory
  10. Oct 27 20:18:09 localhost systemd[1]: Started Apply Kernel Variables.
  11. Oct 27 20:18:09 localhost systemd[1]: Started Create list of required static device nodes for the current kernel.
  12. Oct 27 20:18:09 localhost systemd[1]: Starting Create Static Device Nodes in /dev...
  13. Oct 27 20:18:09 localhost systemd[1]: Mounted RPC Pipe File System.
  14. Oct 27 20:18:09 localhost systemd[1]: Starting pNFS block layout mapping daemon...
  15. Oct 27 20:18:09 localhost systemd[1]: nfs-blkmap.service: Can't open PID file /run/blkmapd.pid (yet?) after start: No such file or directory
  16. Oct 27 20:18:09 localhost systemd[1]: Started pNFS block layout mapping daemon.
  17. Oct 27 20:18:09 localhost systemd[1]: Mounted NFSD configuration filesystem.
  18. Oct 27 20:18:09 localhost systemd[1]: Started Monitoring of LVM2 mirrors, snapshots etc. using dmeventd or progress polling.
  19. Oct 27 20:18:09 localhost systemd[1]: Started Set the console keyboard layout.
  20. Oct 27 20:18:09 localhost systemd[1]: Started Create Static Device Nodes in /dev.
  21. Oct 27 20:18:09 localhost systemd[1]: Reached target Local File Systems (Pre).
  22. Oct 27 20:18:09 localhost systemd[1]: Starting udev Kernel Device Manager...
  23. Oct 27 20:18:09 localhost systemd[1]: Started udev Kernel Device Manager.
  24. Oct 27 20:18:09 localhost systemd[1]: Starting Show Plymouth Boot Screen...
  25. Oct 27 20:18:09 localhost systemd[1]: Started Show Plymouth Boot Screen.
  26. Oct 27 20:18:09 localhost systemd[1]: Reached target Local Encrypted Volumes.
  27. Oct 27 20:18:09 localhost systemd[1]: Started Forward Password Requests to Plymouth Directory Watch.
  28. Oct 27 20:18:09 localhost systemd[1]: Starting Show Plymouth Boot Screen...
  29. Oct 27 20:18:09 localhost systemd[1]: Started Show Plymouth Boot Screen.
  30. Oct 27 20:18:09 localhost systemd[1]: Started Flush Journal to Persistent Storage.
  31. Oct 27 20:18:09 localhost systemd-udevd[432]: link_config: autonegotiation is unset or enabled, the speed and duplex are not writable.
  32. Oct 27 20:18:09 localhost systemd-udevd[430]: link_config: autonegotiation is unset or enabled, the speed and duplex are not writable.
  33. Oct 27 20:18:09 localhost systemd[1]: Listening on Load/Save RF Kill Switch Status /dev/rfkill Watch.
  34. Oct 27 20:18:09 localhost systemd[1]: Reached target Sound Card.
  35. Oct 27 20:18:09 localhost systemd[1]: Found device WDC_WD30EFRX-68AX9N0 4.
  36. Oct 27 20:18:09 localhost systemd[1]: Starting File System Check on /dev/disk/by-uuid/87a6fe9e-d135-4bfc-906c-a4cf854d0206...
  37. Oct 27 20:18:09 localhost systemd[1]: Started File System Check Daemon to report status.
  38. Oct 27 20:18:09 localhost systemd[1]: Found device KINGSTON_SA400S37120G 2.
  39. Oct 27 20:18:09 localhost systemd[1]: Activating swap /dev/disk/by-uuid/7465d9bf-bdf6-4d0e-846d-1f4231df5e43...
  40. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/demux0.
  41. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/dvr0.
  42. Oct 27 20:18:09 localhost systemd-fsck[652]: /dev/sda4: Journal wird wiederhergestellt
  43. Oct 27 20:18:09 localhost systemd[1]: Activated swap /dev/disk/by-uuid/7465d9bf-bdf6-4d0e-846d-1f4231df5e43.
  44. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/net0.
  45. Oct 27 20:18:09 localhost systemd[1]: Reached target Swap.
  46. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/frontend0.
  47. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/demux0.
  48. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/dvr0.
  49. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/net0.
  50. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/frontend0.
  51. Oct 27 20:18:09 localhost systemd[1]: Starting Show Plymouth Boot Screen...
  52. Oct 27 20:18:09 localhost systemd[1]: Started Show Plymouth Boot Screen.
  53. Oct 27 20:18:09 localhost systemd-fsck[652]: /dev/sda4: sauber, 70984/175177728 Dateien, 646892618/700683593 Blöcke
  54. Oct 27 20:18:09 localhost systemd[1]: Started File System Check on /dev/disk/by-uuid/87a6fe9e-d135-4bfc-906c-a4cf854d0206.
  55. Oct 27 20:18:09 localhost systemd[1]: Mounting /srv...
  56. Oct 27 20:18:09 localhost systemd[1]: Mounted /srv.
  57. Oct 27 20:18:09 localhost systemd[1]: Reached target Local File Systems.
  58. Oct 27 20:18:09 localhost systemd[1]: Starting Preprocess NFS configuration...
  59. Oct 27 20:18:09 localhost systemd[1]: Starting AppArmor initialization...
  60. Oct 27 20:18:09 localhost systemd[1]: Starting Set console font and keymap...
  61. Oct 27 20:18:09 localhost systemd[1]: Starting Create Volatile Files and Directories...
  62. Oct 27 20:18:09 localhost systemd[1]: Starting ebtables ruleset management...
  63. Oct 27 20:18:09 localhost systemd[1]: Starting Tell Plymouth To Write Out Runtime Data...
  64. Oct 27 20:18:09 localhost systemd[1]: Started Preprocess NFS configuration.
  65. Oct 27 20:18:09 localhost systemd[1]: Reached target NFS client services.
  66. Oct 27 20:18:09 localhost systemd[1]: Starting NFSv4 ID-name mapping service...
  67. Oct 27 20:18:09 localhost systemd[1]: Started Set console font and keymap.
  68. Oct 27 20:18:09 localhost systemd[1]: Started NFSv4 ID-name mapping service.
  69. Oct 27 20:18:09 localhost systemd[1]: Started Tell Plymouth To Write Out Runtime Data.
  70. Oct 27 20:18:09 localhost systemd[1]: Started Create Volatile Files and Directories.
  71. Oct 27 20:18:09 localhost systemd[1]: Starting Update UTMP about System Boot/Shutdown...
  72. Oct 27 20:18:09 localhost systemd[1]: Starting Network Time Synchronization...
  73. Oct 27 20:18:09 localhost systemd[1]: Starting RPC bind portmap service...
  74. Oct 27 20:18:09 localhost systemd[1]: Started RPC bind portmap service.
  75. Oct 27 20:18:09 localhost systemd[1]: Reached target RPC Port Mapper.
  76. Oct 27 20:18:09 localhost systemd[1]: Started Update UTMP about System Boot/Shutdown.
  77. Oct 27 20:18:09 localhost systemd[1]: Received SIGRTMIN+20 from PID 280 (plymouthd).
  78. Oct 27 20:18:09 localhost systemd[1]: Started ebtables ruleset management.
  79. Oct 27 20:18:09 localhost apparmor[728]: * Starting AppArmor profiles
  80. Oct 27 20:18:09 localhost systemd[1]: Reached target Network (Pre).
  81. Oct 27 20:18:09 localhost systemd[1]: Starting Network Service...
  82. Oct 27 20:18:09 localhost systemd-networkd[765]: Enumeration completed
  83. Oct 27 20:18:09 localhost systemd[1]: Started Network Service.
  84. Oct 27 20:18:09 localhost systemd-networkd[765]: lo: Link is not managed by us
  85. Oct 27 20:18:09 localhost systemd-networkd[765]: enp5s0: IPv6 successfully enabled
  86. Oct 27 20:18:09 localhost systemd[1]: Starting Network Name Resolution...
  87. Oct 27 20:18:09 localhost systemd[1]: Starting Wait for Network to be Configured...
  88. Oct 27 20:18:09 localhost systemd-networkd-wait-online[791]: ignoring: lo
  89. Oct 27 20:18:09 localhost systemd[1]: Started Network Time Synchronization.
  90. Oct 27 20:18:09 localhost systemd[1]: Reached target System Time Synchronized.
  91. Oct 27 20:18:09 localhost systemd-networkd-wait-online[791]: ignoring: lo
  92. Oct 27 20:18:09 localhost systemd-networkd[765]: enp5s0: Gained carrier
  93. Oct 27 20:18:09 localhost systemd-networkd-wait-online[791]: ignoring: lo
  94. Oct 27 20:18:09 localhost systemd-timesyncd[762]: Network configuration changed, trying to establish connection.
  95. Oct 27 20:18:09 localhost apparmor[728]: Skipping profile in /etc/apparmor.d/disable: usr.bin.firefox
  96. Oct 27 20:18:09 localhost apparmor[728]: Skipping profile in /etc/apparmor.d/disable: usr.sbin.rsyslogd
  97. Oct 27 20:18:09 localhost apparmor[728]: ...done.
  98. Oct 27 20:18:09 localhost systemd-resolved[790]: Positive Trust Anchors:
  99. Oct 27 20:18:09 localhost systemd-resolved[790]: . IN DS 19036 8 2 49aac11d7b6f6446702e54a1607371607a1a41855200fd2ce1cdde32f24e8fb5
  100. Oct 27 20:18:09 localhost systemd-resolved[790]: . IN DS 20326 8 2 e06d44b80b8f1d39a95c0b0d7c65d08458e880409bbc683457104237c7f8ec8d
  101. Oct 27 20:18:09 localhost systemd-resolved[790]: Negative trust anchors: 10.in-addr.arpa 16.172.in-addr.arpa 17.172.in-addr.arpa 18.172.in-addr.arpa 19.172.in-addr.arpa 20.172.in-addr.arpa 21.172.in-addr.arpa 22.172.in-addr.arpa 23.172.in-addr.arpa 24.172.in-addr.arpa 25.172.in-addr.arpa 26.172.in-addr.arpa 27.172.in-addr.arpa 28.172.in-addr.arpa 29.172.in-addr.arpa 30.172.in-addr.arpa 31.172.in-addr.arpa 168.192.in-addr.arpa d.f.ip6.arpa corp home internal intranet lan local private test
  102. Oct 27 20:18:09 localhost systemd-resolved[790]: Using system hostname 'myVDR'.
  103. Oct 27 20:18:09 localhost systemd[1]: Started Network Name Resolution.
  104. Oct 27 20:18:09 localhost systemd[1]: Reached target Host and Network Name Lookups.
  105. Oct 27 20:18:09 localhost systemd[1]: Started AppArmor initialization.
  106. Oct 27 20:18:09 localhost systemd[1]: Reached target System Initialization.
  107. Oct 27 20:18:09 localhost systemd[1]: Listening on ACPID Listen Socket.
  108. Oct 27 20:18:09 localhost systemd[1]: Listening on Open-iSCSI iscsid Socket.
  109. Oct 27 20:18:09 localhost systemd[1]: Listening on Avahi mDNS/DNS-SD Stack Activation Socket.
  110. Oct 27 20:18:09 localhost systemd[1]: Started ACPI Events Check.
  111. Oct 27 20:18:09 localhost systemd[1]: Started Daily apt download activities.
  112. Oct 27 20:18:09 localhost systemd[1]: Listening on eventlircd.socket.
  113. Oct 27 20:18:09 localhost systemd[1]: Starting Socket activation for snappy daemon.
  114. Oct 27 20:18:09 localhost systemd[1]: Listening on UUID daemon activation socket.
  115. Oct 27 20:18:09 localhost systemd[1]: Started Trigger anacron every hour.
  116. Oct 27 20:18:09 localhost systemd[1]: Started Discard unused blocks once a week.
  117. Oct 27 20:18:09 localhost systemd[1]: Listening on D-Bus System Message Bus Socket.
  118. Oct 27 20:18:09 localhost systemd[1]: Started Daily Cleanup of Temporary Directories.
  119. Oct 27 20:18:09 localhost systemd[1]: Started Daily apt upgrade and clean activities.
  120. Oct 27 20:18:09 localhost systemd[1]: Started Message of the Day.
  121. Oct 27 20:18:09 localhost systemd[1]: Reached target Timers.
  122. Oct 27 20:18:09 localhost systemd[1]: Starting LXD - unix socket.
  123. Oct 27 20:18:09 localhost systemd[1]: Reached target Paths.
  124. Oct 27 20:18:09 localhost systemd[1]: Listening on Socket activation for snappy daemon.
  125. Oct 27 20:18:09 localhost systemd[1]: Listening on LXD - unix socket.
  126. Oct 27 20:18:09 localhost systemd[1]: Reached target Sockets.
  127. Oct 27 20:18:09 localhost systemd[1]: Reached target Basic System.
  128. Oct 27 20:18:09 localhost systemd[1]: Started Run anacron jobs.
  129. Oct 27 20:18:09 localhost systemd[1]: Starting LXD - container startup/shutdown...
  130. Oct 27 20:18:09 localhost systemd[1]: Started VDR ACPI power button handling daemon.
  131. Oct 27 20:18:09 localhost anacron[849]: Anacron 2.3 started on 2019-10-27
  132. Oct 27 20:18:09 localhost systemd[1]: Starting wait-for-dvb@0.service...
  133. Oct 27 20:18:09 localhost systemd[1]: Started Handle events from IR remotes decoded by lircd(8).
  134. Oct 27 20:18:09 localhost anacron[849]: Normal exit (0 jobs run)
  135. Oct 27 20:18:09 localhost systemd[1]: Started "eventlircd reads from kernel input devices and generates key presses on a lircd socket".
  136. Oct 27 20:18:09 localhost wait-for-dvb: got device 0
  137. Oct 27 20:18:09 localhost systemd[1]: Started Deferred execution scheduler.
  138. Oct 27 20:18:09 localhost systemd[1]: Starting Avahi mDNS/DNS-SD Stack...
  139. Oct 27 20:18:09 localhost systemd[1]: Starting wait-for-dvb@1.service...
  140. Oct 27 20:18:09 localhost systemd[1]: Starting Dispatcher daemon for systemd-networkd...
  141. Oct 27 20:18:09 localhost systemd[1]: Starting Login Service...
  142. Oct 27 20:18:09 localhost wait-for-dvb: got device 1
  143. Oct 27 20:18:09 localhost systemd[1]: Started Regular background program processing daemon.
  144. Oct 27 20:18:09 localhost systemd[1]: Starting LSB: Record successful boot for GRUB...
  145. Oct 27 20:18:09 localhost systemd[1]: Starting System Logging Service...
  146. Oct 27 20:18:09 localhost cron[869]: (CRON) INFO (pidfile fd = 3)
  147. Oct 27 20:18:09 localhost systemd[1]: Started Set the CPU Frequency Scaling governor.
  148. Oct 27 20:18:09 localhost systemd[1]: Starting Snappy daemon...
  149. Oct 27 20:18:09 localhost systemd[1]: Starting Initialize hardware monitoring sensors...
  150. Oct 27 20:18:09 localhost systemd[1]: Started irqbalance daemon.
  151. Oct 27 20:18:09 localhost systemd[1]: Started FUSE filesystem for LXC.
  152. Oct 27 20:18:09 localhost systemd[1]: Starting lircd(8) initialization helper tool...
  153. Oct 27 20:18:09 localhost systemd[1]: Starting Disk Manager...
  154. Oct 27 20:18:09 localhost systemd[1]: Starting Save/Restore Sound Card State...
  155. Oct 27 20:18:09 localhost systemd[1]: Starting Accounts Service...
  156. Oct 27 20:18:09 localhost systemd[1]: Started D-Bus System Message Bus.
  157. Oct 27 20:18:09 localhost dbus-daemon[883]: [system] AppArmor D-Bus mediation is enabled
  158. Oct 27 20:18:09 localhost systemd[1]: Starting WPA supplicant...
  159. Oct 27 20:18:09 localhost systemd[1]: Started lifeguard for system services.
  160. Oct 27 20:18:09 localhost systemd[1]: Started wait-for-dvb@0.service.
  161. Oct 27 20:18:09 localhost systemd[1]: Started wait-for-dvb@1.service.
  162. Oct 27 20:18:09 localhost avahi-daemon[860]: Found user 'avahi' (UID 113) and group 'avahi' (GID 117).
  163. Oct 27 20:18:09 localhost kernel: [ 0.000000] microcode: microcode updated early to revision 0x2f, date = 2019-02-17
  164. Oct 27 20:18:09 localhost kernel: [ 0.000000] Linux version 4.15.0-66-generic (buildd@lgw01-amd64-044) (gcc version 7.4.0 (Ubuntu 7.4.0-1ubuntu1~18.04.1)) #75-Ubuntu SMP Tue Oct 1 05:24:09 UTC 2019 (Ubuntu 4.15.0-66.75-generic 4.15.18)
  165. Oct 27 20:18:09 localhost kernel: [ 0.000000] Command line: BOOT_IMAGE=/boot/vmlinuz-4.15.0-66-generic root=UUID=3a2488fb-8ae8-4722-b647-c95071d7e0af ro quiet splash vt.handoff=1
  166. Oct 27 20:18:09 localhost kernel: [ 0.000000] KERNEL supported cpus:
  167. Oct 27 20:18:09 localhost kernel: [ 0.000000] Intel GenuineIntel
  168. Oct 27 20:18:09 localhost kernel: [ 0.000000] AMD AuthenticAMD
  169. Oct 27 20:18:09 localhost kernel: [ 0.000000] Centaur CentaurHauls
  170. Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/fpu: Supporting XSAVE feature 0x001: 'x87 floating point registers'
  171. Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/fpu: Supporting XSAVE feature 0x002: 'SSE registers'
  172. Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/fpu: Enabled xstate features 0x3, context size is 576 bytes, using 'standard' format.
  173. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: BIOS-provided physical RAM map:
  174. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x0000000000000000-0x000000000009d7ff] usable
  175. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x000000000009d800-0x000000000009ffff] reserved
  176. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000000e0000-0x00000000000fffff] reserved
  177. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x0000000000100000-0x00000000df58ffff] usable
  178. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df590000-0x00000000df5d5fff] ACPI NVS
  179. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df5d6000-0x00000000df5ddfff] ACPI data
  180. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df5de000-0x00000000df60afff] reserved
  181. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df60b000-0x00000000df60bfff] usable
  182. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df60c000-0x00000000df60cfff] ACPI data
  183. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df60d000-0x00000000df615fff] ACPI NVS
  184. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df616000-0x00000000df63dfff] reserved
  185. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df63e000-0x00000000df680fff] ACPI NVS
  186. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df681000-0x00000000df7fffff] usable
  187. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000fed1c000-0x00000000fed3ffff] reserved
  188. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000ff000000-0x00000000ffffffff] reserved
  189. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x0000000100000000-0x000000011f7fffff] usable
  190. Oct 27 20:18:09 localhost kernel: [ 0.000000] NX (Execute Disable) protection: active
  191. Oct 27 20:18:09 localhost kernel: [ 0.000000] SMBIOS 2.7 present.
  192. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMI: To Be Filled By O.E.M. To Be Filled By O.E.M./H61M-GE, BIOS P1.30 08/31/2011
  193. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: update [mem 0x00000000-0x00000fff] usable ==> reserved
  194. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: remove [mem 0x000a0000-0x000fffff] usable
  195. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: last_pfn = 0x11f800 max_arch_pfn = 0x400000000
  196. Oct 27 20:18:09 localhost kernel: [ 0.000000] MTRR default type: uncachable
  197. Oct 27 20:18:09 localhost kernel: [ 0.000000] MTRR fixed ranges enabled:
  198. Oct 27 20:18:09 localhost kernel: [ 0.000000] 00000-9FFFF write-back
  199. Oct 27 20:18:09 localhost kernel: [ 0.000000] A0000-BFFFF uncachable
  200. Oct 27 20:18:09 localhost kernel: [ 0.000000] C0000-CFFFF write-protect
  201. Oct 27 20:18:09 localhost kernel: [ 0.000000] D0000-E7FFF uncachable
  202. Oct 27 20:18:09 localhost kernel: [ 0.000000] E8000-FFFFF write-protect
  203. Oct 27 20:18:09 localhost kernel: [ 0.000000] MTRR variable ranges enabled:
  204. Oct 27 20:18:09 localhost kernel: [ 0.000000] 0 base 000000000 mask F00000000 write-back
  205. Oct 27 20:18:09 localhost kernel: [ 0.000000] 1 base 100000000 mask FE0000000 write-back
  206. Oct 27 20:18:09 localhost kernel: [ 0.000000] 2 base 0E0000000 mask FE0000000 uncachable
  207. Oct 27 20:18:09 localhost kernel: [ 0.000000] 3 base 11F800000 mask FFF800000 uncachable
  208. Oct 27 20:18:09 localhost kernel: [ 0.000000] 4 disabled
  209. Oct 27 20:18:09 localhost kernel: [ 0.000000] 5 disabled
  210. Oct 27 20:18:09 localhost kernel: [ 0.000000] 6 disabled
  211. Oct 27 20:18:09 localhost kernel: [ 0.000000] 7 disabled
  212. Oct 27 20:18:09 localhost kernel: [ 0.000000] 8 disabled
  213. Oct 27 20:18:09 localhost kernel: [ 0.000000] 9 disabled
  214. Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/PAT: Configuration [0-7]: WB WC UC- UC WB WP UC- WT
  215. Oct 27 20:18:09 localhost kernel: [ 0.000000] total RAM covered: 4088M
  216. Oct 27 20:18:09 localhost kernel: [ 0.000000] Found optimal setting for mtrr clean up
  217. Oct 27 20:18:09 localhost kernel: [ 0.000000] gran_size: 64K chunk_size: 16M num_reg: 5 lose cover RAM: 0G
  218. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: update [mem 0xe0000000-0xffffffff] usable ==> reserved
  219. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: last_pfn = 0xdf800 max_arch_pfn = 0x400000000
  220. Oct 27 20:18:09 localhost kernel: [ 0.000000] found SMP MP-table at [mem 0x000fceb0-0x000fcebf]
  221. Oct 27 20:18:09 localhost kernel: [ 0.000000] Scanning 1 areas for low memory corruption
  222. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38141000, 0x38141fff] PGTABLE
  223. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38142000, 0x38142fff] PGTABLE
  224. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38143000, 0x38143fff] PGTABLE
  225. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38144000, 0x38144fff] PGTABLE
  226. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38145000, 0x38145fff] PGTABLE
  227. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38146000, 0x38146fff] PGTABLE
  228. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38147000, 0x38147fff] PGTABLE
  229. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38148000, 0x38148fff] PGTABLE
  230. Oct 27 20:18:09 localhost kernel: [ 0.000000] RAMDISK: [mem 0x2f9c9000-0x33cdbfff]
  231. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Early table checksum verification disabled
  232. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: RSDP 0x00000000000F0450 000024 (v02 ALASKA)
  233. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: XSDT 0x00000000DF5D6068 000054 (v01 ALASKA A M I 01072009 AMI 00010013)
  234. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: FACP 0x00000000DF5DD6A8 0000F4 (v04 ALASKA A M I 01072009 AMI 00010013)
  235. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: DSDT 0x00000000DF5D6150 007556 (v02 ALASKA A M I 00000000 INTL 20051117)
  236. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: FACS 0x00000000DF60DF80 000040
  237. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: APIC 0x00000000DF5DD7A0 000062 (v03 ALASKA A M I 01072009 AMI 00010013)
  238. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: SSDT 0x00000000DF5DD808 000098 (v01 AMICPU PROC 00000001 MSFT 03000001)
  239. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: MCFG 0x00000000DF5DD8A0 00003C (v01 ALASKA A M I 01072009 MSFT 00000097)
  240. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: AAFT 0x00000000DF5DD8E0 0000BA (v01 ALASKA OEMAAFT 01072009 MSFT 00000097)
  241. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: HPET 0x00000000DF5DD9A0 000038 (v01 ALASKA A M I 01072009 AMI. 00000004)
  242. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Local APIC address 0xfee00000
  243. Oct 27 20:18:09 localhost kernel: [ 0.000000] No NUMA configuration found
  244. Oct 27 20:18:09 localhost kernel: [ 0.000000] Faking a node at [mem 0x0000000000000000-0x000000011f7fffff]
  245. Oct 27 20:18:09 localhost kernel: [ 0.000000] NODE_DATA(0) allocated [mem 0x11f7d3000-0x11f7fdfff]
  246. Oct 27 20:18:09 localhost kernel: [ 0.000000] tsc: Fast TSC calibration using PIT
  247. Oct 27 20:18:09 localhost kernel: [ 0.000000] Zone ranges:
  248. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA [mem 0x0000000000001000-0x0000000000ffffff]
  249. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA32 [mem 0x0000000001000000-0x00000000ffffffff]
  250. Oct 27 20:18:09 localhost kernel: [ 0.000000] Normal [mem 0x0000000100000000-0x000000011f7fffff]
  251. Oct 27 20:18:09 localhost kernel: [ 0.000000] Device empty
  252. Oct 27 20:18:09 localhost kernel: [ 0.000000] Movable zone start for each node
  253. Oct 27 20:18:09 localhost kernel: [ 0.000000] Early memory node ranges
  254. Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x0000000000001000-0x000000000009cfff]
  255. Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x0000000000100000-0x00000000df58ffff]
  256. Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x00000000df60b000-0x00000000df60bfff]
  257. Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x00000000df681000-0x00000000df7fffff]
  258. Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x0000000100000000-0x000000011f7fffff]
  259. Oct 27 20:18:09 localhost kernel: [ 0.000000] Reserved but unavailable: 100 pages
  260. Oct 27 20:18:09 localhost kernel: [ 0.000000] Initmem setup node 0 [mem 0x0000000000001000-0x000000011f7fffff]
  261. Oct 27 20:18:09 localhost kernel: [ 0.000000] On node 0 totalpages: 1044140
  262. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA zone: 64 pages used for memmap
  263. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA zone: 21 pages reserved
  264. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA zone: 3996 pages, LIFO batch:0
  265. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA32 zone: 14237 pages used for memmap
  266. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA32 zone: 911120 pages, LIFO batch:31
  267. Oct 27 20:18:09 localhost kernel: [ 0.000000] Normal zone: 2016 pages used for memmap
  268. Oct 27 20:18:09 localhost kernel: [ 0.000000] Normal zone: 129024 pages, LIFO batch:31
  269. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: PM-Timer IO Port: 0x408
  270. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Local APIC address 0xfee00000
  271. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: LAPIC_NMI (acpi_id[0xff] high edge lint[0x1])
  272. Oct 27 20:18:09 localhost kernel: [ 0.000000] IOAPIC[0]: apic_id 0, version 32, address 0xfec00000, GSI 0-23
  273. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: INT_SRC_OVR (bus 0 bus_irq 0 global_irq 2 dfl dfl)
  274. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: INT_SRC_OVR (bus 0 bus_irq 9 global_irq 9 high level)
  275. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: IRQ0 used by override.
  276. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: IRQ9 used by override.
  277. Oct 27 20:18:09 localhost kernel: [ 0.000000] Using ACPI (MADT) for SMP configuration information
  278. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: HPET id: 0x8086a701 base: 0xfed00000
  279. Oct 27 20:18:09 localhost kernel: [ 0.000000] smpboot: Allowing 2 CPUs, 0 hotplug CPUs
  280. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x00000000-0x00000fff]
  281. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x0009d000-0x0009dfff]
  282. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x0009e000-0x0009ffff]
  283. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x000a0000-0x000dffff]
  284. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x000e0000-0x000fffff]
  285. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf590000-0xdf5d5fff]
  286. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf5d6000-0xdf5ddfff]
  287. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf5de000-0xdf60afff]
  288. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf60c000-0xdf60cfff]
  289. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf60d000-0xdf615fff]
  290. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf616000-0xdf63dfff]
  291. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf63e000-0xdf680fff]
  292. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf800000-0xfed1bfff]
  293. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xfed1c000-0xfed3ffff]
  294. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xfed40000-0xfeffffff]
  295. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xff000000-0xffffffff]
  296. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: [mem 0xdf800000-0xfed1bfff] available for PCI devices
  297. Oct 27 20:18:09 localhost kernel: [ 0.000000] Booting paravirtualized kernel on bare hardware
  298. Oct 27 20:18:09 localhost kernel: [ 0.000000] clocksource: refined-jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 7645519600211568 ns
  299. Oct 27 20:18:09 localhost kernel: [ 0.000000] random: get_random_bytes called from start_kernel+0x99/0x4fd with crng_init=0
  300. Oct 27 20:18:09 localhost kernel: [ 0.000000] setup_percpu: NR_CPUS:8192 nr_cpumask_bits:2 nr_cpu_ids:2 nr_node_ids:1
  301. Oct 27 20:18:09 localhost kernel: [ 0.000000] percpu: Embedded 46 pages/cpu s151552 r8192 d28672 u1048576
  302. Oct 27 20:18:09 localhost kernel: [ 0.000000] pcpu-alloc: s151552 r8192 d28672 u1048576 alloc=1*2097152
  303. Oct 27 20:18:09 localhost kernel: [ 0.000000] pcpu-alloc: [0] 0 1
  304. Oct 27 20:18:09 localhost kernel: [ 0.000000] Built 1 zonelists, mobility grouping on. Total pages: 1027802
  305. Oct 27 20:18:09 localhost kernel: [ 0.000000] Policy zone: Normal
  306. Oct 27 20:18:09 localhost kernel: [ 0.000000] Kernel command line: BOOT_IMAGE=/boot/vmlinuz-4.15.0-66-generic root=UUID=3a2488fb-8ae8-4722-b647-c95071d7e0af ro quiet splash vt.handoff=1
  307. Oct 27 20:18:09 localhost kernel: [ 0.000000] Calgary: detecting Calgary via BIOS EBDA area
  308. Oct 27 20:18:09 localhost kernel: [ 0.000000] Calgary: Unable to locate Rio Grande table in EBDA - bailing!
  309. Oct 27 20:18:09 localhost kernel: [ 0.000000] Memory: 3947744K/4176560K available (12300K kernel code, 2481K rwdata, 4260K rodata, 2436K init, 2388K bss, 228816K reserved, 0K cma-reserved)
  310. Oct 27 20:18:09 localhost kernel: [ 0.000000] SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=2, Nodes=1
  311. Oct 27 20:18:09 localhost kernel: [ 0.000000] Kernel/User page tables isolation: enabled
  312. Oct 27 20:18:09 localhost kernel: [ 0.000000] ftrace: allocating 39306 entries in 154 pages
  313. Oct 27 20:18:09 localhost kernel: [ 0.000000] Hierarchical RCU implementation.
  314. Oct 27 20:18:09 localhost kernel: [ 0.000000] RCU restricting CPUs from NR_CPUS=8192 to nr_cpu_ids=2.
  315. Oct 27 20:18:09 localhost kernel: [ 0.000000] Tasks RCU enabled.
  316. Oct 27 20:18:09 localhost kernel: [ 0.000000] RCU: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=2
  317. Oct 27 20:18:09 localhost kernel: [ 0.000000] NR_IRQS: 524544, nr_irqs: 440, preallocated irqs: 16
  318. Oct 27 20:18:09 localhost kernel: [ 0.000000] vt handoff: transparent VT on vt#1
  319. Oct 27 20:18:09 localhost kernel: [ 0.000000] Console: colour dummy device 80x25
  320. Oct 27 20:18:09 localhost kernel: [ 0.000000] console [tty0] enabled
  321. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Core revision 20170831
  322. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: 2 ACPI AML tables successfully acquired and loaded
  323. Oct 27 20:18:09 localhost kernel: [ 0.000000] clocksource: hpet: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 133484882848 ns
  324. Oct 27 20:18:09 localhost kernel: [ 0.000000] hpet clockevent registered
  325. Oct 27 20:18:09 localhost kernel: [ 0.000000] APIC: Switch to symmetric I/O mode setup
  326. Oct 27 20:18:09 localhost kernel: [ 0.000000] ..TIMER: vector=0x30 apic1=0 pin1=2 apic2=-1 pin2=-1
  327. Oct 27 20:18:09 localhost kernel: [ 0.020000] tsc: Fast TSC calibration using PIT
  328. Oct 27 20:18:09 localhost kernel: [ 0.024000] tsc: Detected 2394.533 MHz processor
  329. Oct 27 20:18:09 localhost kernel: [ 0.024000] Calibrating delay loop (skipped), value calculated using timer frequency.. 4789.06 BogoMIPS (lpj=9578132)
  330. Oct 27 20:18:09 localhost kernel: [ 0.024000] pid_max: default: 32768 minimum: 301
  331. Oct 27 20:18:09 localhost kernel: [ 0.024000] Security Framework initialized
  332. Oct 27 20:18:09 localhost kernel: [ 0.024000] Yama: becoming mindful.
  333. Oct 27 20:18:09 localhost kernel: [ 0.024000] AppArmor: AppArmor initialized
  334. Oct 27 20:18:09 localhost kernel: [ 0.024000] Dentry cache hash table entries: 524288 (order: 10, 4194304 bytes)
  335. Oct 27 20:18:09 localhost kernel: [ 0.024000] Inode-cache hash table entries: 262144 (order: 9, 2097152 bytes)
  336. Oct 27 20:18:09 localhost kernel: [ 0.024000] Mount-cache hash table entries: 8192 (order: 4, 65536 bytes)
  337. Oct 27 20:18:09 localhost kernel: [ 0.024000] Mountpoint-cache hash table entries: 8192 (order: 4, 65536 bytes)
  338. Oct 27 20:18:09 localhost kernel: [ 0.024000] ENERGY_PERF_BIAS: Set to 'normal', was 'performance'
  339. Oct 27 20:18:09 localhost kernel: [ 0.024000] ENERGY_PERF_BIAS: View and update with x86_energy_perf_policy(8)
  340. Oct 27 20:18:09 localhost kernel: [ 0.024000] CPU0: Thermal monitoring enabled (TM1)
  341. Oct 27 20:18:09 localhost kernel: [ 0.024000] process: using mwait in idle threads
  342. Oct 27 20:18:09 localhost kernel: [ 0.024000] Last level iTLB entries: 4KB 512, 2MB 8, 4MB 8
  343. Oct 27 20:18:09 localhost kernel: [ 0.024000] Last level dTLB entries: 4KB 512, 2MB 32, 4MB 32, 1GB 0
  344. Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V1 : Mitigation: usercopy/swapgs barriers and __user pointer sanitization
  345. Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : Mitigation: Full generic retpoline
  346. Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : Spectre v2 / SpectreRSB mitigation: Filling RSB on context switch
  347. Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : Enabling Restricted Speculation for firmware calls
  348. Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : mitigation: Enabling conditional Indirect Branch Prediction Barrier
  349. Oct 27 20:18:09 localhost kernel: [ 0.024000] Speculative Store Bypass: Mitigation: Speculative Store Bypass disabled via prctl and seccomp
  350. Oct 27 20:18:09 localhost kernel: [ 0.024000] MDS: Mitigation: Clear CPU buffers
  351. Oct 27 20:18:09 localhost kernel: [ 0.024000] Freeing SMP alternatives memory: 36K
  352. Oct 27 20:18:09 localhost kernel: [ 0.031329] TSC deadline timer enabled
  353. Oct 27 20:18:09 localhost kernel: [ 0.031332] smpboot: CPU0: Intel(R) Celeron(R) CPU G530 @ 2.40GHz (family: 0x6, model: 0x2a, stepping: 0x7)
  354. Oct 27 20:18:09 localhost kernel: [ 0.031410] Performance Events: PEBS fmt1+, SandyBridge events, 16-deep LBR, full-width counters, Intel PMU driver.
  355. Oct 27 20:18:09 localhost kernel: [ 0.031435] ... version: 3
  356. Oct 27 20:18:09 localhost kernel: [ 0.031435] ... bit width: 48
  357. Oct 27 20:18:09 localhost kernel: [ 0.031436] ... generic registers: 8
  358. Oct 27 20:18:09 localhost kernel: [ 0.031437] ... value mask: 0000ffffffffffff
  359. Oct 27 20:18:09 localhost kernel: [ 0.031437] ... max period: 00007fffffffffff
  360. Oct 27 20:18:09 localhost kernel: [ 0.031438] ... fixed-purpose events: 3
  361. Oct 27 20:18:09 localhost kernel: [ 0.031438] ... event mask: 00000007000000ff
  362. Oct 27 20:18:09 localhost kernel: [ 0.031482] Hierarchical SRCU implementation.
  363. Oct 27 20:18:09 localhost kernel: [ 0.032000] NMI watchdog: Enabled. Permanently consumes one hw-PMU counter.
  364. Oct 27 20:18:09 localhost kernel: [ 0.032000] smp: Bringing up secondary CPUs ...
  365. Oct 27 20:18:09 localhost kernel: [ 0.032000] x86: Booting SMP configuration:
  366. Oct 27 20:18:09 localhost kernel: [ 0.032000] .... node #0, CPUs: #1
  367. Oct 27 20:18:09 localhost kernel: [ 0.032028] smp: Brought up 1 node, 2 CPUs
  368. Oct 27 20:18:09 localhost kernel: [ 0.032028] smpboot: Max logical packages: 1
  369. Oct 27 20:18:09 localhost kernel: [ 0.032028] smpboot: Total of 2 processors activated (9578.13 BogoMIPS)
  370. Oct 27 20:18:09 localhost kernel: [ 0.033215] devtmpfs: initialized
  371. Oct 27 20:18:09 localhost kernel: [ 0.033215] x86/mm: Memory block size: 128MB
  372. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.selinux
  373. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64
  374. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64EXEC
  375. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64TRANSMUTE
  376. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64MMAP
  377. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.apparmor
  378. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.ima
  379. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.capability
  380. Oct 27 20:18:09 localhost kernel: [ 0.033215] PM: Registering ACPI NVS region [mem 0xdf590000-0xdf5d5fff] (286720 bytes)
  381. Oct 27 20:18:09 localhost kernel: [ 0.033215] PM: Registering ACPI NVS region [mem 0xdf60d000-0xdf615fff] (36864 bytes)
  382. Oct 27 20:18:09 localhost kernel: [ 0.033215] PM: Registering ACPI NVS region [mem 0xdf63e000-0xdf680fff] (274432 bytes)
  383. Oct 27 20:18:09 localhost kernel: [ 0.033215] clocksource: jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 7645041785100000 ns
  384. Oct 27 20:18:09 localhost kernel: [ 0.033215] futex hash table entries: 512 (order: 3, 32768 bytes)
  385. Oct 27 20:18:09 localhost kernel: [ 0.033215] pinctrl core: initialized pinctrl subsystem
  386. Oct 27 20:18:09 localhost kernel: [ 0.033215] RTC time: 19:18:01, date: 10/27/19
  387. Oct 27 20:18:09 localhost kernel: [ 0.033215] NET: Registered protocol family 16
  388. Oct 27 20:18:09 localhost kernel: [ 0.033215] audit: initializing netlink subsys (disabled)
  389. Oct 27 20:18:09 localhost kernel: [ 0.033215] audit: type=2000 audit(1572203881.032:1): state=initialized audit_enabled=0 res=1
  390. Oct 27 20:18:09 localhost kernel: [ 0.033215] cpuidle: using governor ladder
  391. Oct 27 20:18:09 localhost kernel: [ 0.033215] cpuidle: using governor menu
  392. Oct 27 20:18:09 localhost kernel: [ 0.033215] ACPI: bus type PCI registered
  393. Oct 27 20:18:09 localhost kernel: [ 0.033215] acpiphp: ACPI Hot Plug PCI Controller Driver version: 0.5
  394. Oct 27 20:18:09 localhost kernel: [ 0.033215] PCI: MMCONFIG for domain 0000 [bus 00-ff] at [mem 0xe0000000-0xefffffff] (base 0xe0000000)
  395. Oct 27 20:18:09 localhost kernel: [ 0.033215] PCI: not using MMCONFIG
  396. Oct 27 20:18:09 localhost kernel: [ 0.033215] PCI: Using configuration type 1 for base access
  397. Oct 27 20:18:09 localhost kernel: [ 0.033215] core: PMU erratum BJ122, BV98, HSD29 workaround disabled, HT off
  398. Oct 27 20:18:09 localhost kernel: [ 0.033232] HugeTLB registered 2.00 MiB page size, pre-allocated 0 pages
  399. Oct 27 20:18:09 localhost kernel: [ 0.036082] ACPI: Added _OSI(Module Device)
  400. Oct 27 20:18:09 localhost kernel: [ 0.036083] ACPI: Added _OSI(Processor Device)
  401. Oct 27 20:18:09 localhost kernel: [ 0.036084] ACPI: Added _OSI(3.0 _SCP Extensions)
  402. Oct 27 20:18:09 localhost kernel: [ 0.036084] ACPI: Added _OSI(Processor Aggregator Device)
  403. Oct 27 20:18:09 localhost kernel: [ 0.036086] ACPI: Added _OSI(Linux-Dell-Video)
  404. Oct 27 20:18:09 localhost kernel: [ 0.036087] ACPI: Added _OSI(Linux-Lenovo-NV-HDMI-Audio)
  405. Oct 27 20:18:09 localhost kernel: [ 0.036087] ACPI: Added _OSI(Linux-HPI-Hybrid-Graphics)
  406. Oct 27 20:18:09 localhost kernel: [ 0.036296] ACPI: Executed 1 blocks of module-level executable AML code
  407. Oct 27 20:18:09 localhost kernel: [ 0.041863] ACPI: Dynamic OEM Table Load:
  408. Oct 27 20:18:09 localhost kernel: [ 0.041868] ACPI: SSDT 0xFFFF9E6BD9DA3C00 0001D8 (v01 AMI IST 00000001 MSFT 03000001)
  409. Oct 27 20:18:09 localhost kernel: [ 0.042080] ACPI: Dynamic OEM Table Load:
  410. Oct 27 20:18:09 localhost kernel: [ 0.042083] ACPI: SSDT 0xFFFF9E6BD9D4FA80 000054 (v01 AMI CST 00000001 MSFT 03000001)
  411. Oct 27 20:18:09 localhost kernel: [ 0.043060] ACPI: Interpreter enabled
  412. Oct 27 20:18:09 localhost kernel: [ 0.043079] ACPI: (supports S0 S1 S3 S4 S5)
  413. Oct 27 20:18:09 localhost kernel: [ 0.043080] ACPI: Using IOAPIC for interrupt routing
  414. Oct 27 20:18:09 localhost kernel: [ 0.043115] PCI: MMCONFIG for domain 0000 [bus 00-ff] at [mem 0xe0000000-0xefffffff] (base 0xe0000000)
  415. Oct 27 20:18:09 localhost kernel: [ 0.043219] PCI: MMCONFIG at [mem 0xe0000000-0xefffffff] reserved in ACPI motherboard resources
  416. Oct 27 20:18:09 localhost kernel: [ 0.043234] PCI: Using host bridge windows from ACPI; if necessary, use "pci=nocrs" and report a bug
  417. Oct 27 20:18:09 localhost kernel: [ 0.043662] ACPI: GPE 0x1B active on init
  418. Oct 27 20:18:09 localhost kernel: [ 0.043677] ACPI: Enabled 8 GPEs in block 00 to 3F
  419. Oct 27 20:18:09 localhost kernel: [ 0.043939] ACPI: [Firmware Bug]: BIOS _OSI(Linux) query ignored
  420. Oct 27 20:18:09 localhost kernel: [ 0.053280] ACPI: PCI Root Bridge [PCI0] (domain 0000 [bus 00-ff])
  421. Oct 27 20:18:09 localhost kernel: [ 0.053285] acpi PNP0A08:00: _OSC: OS supports [ExtendedConfig ASPM ClockPM Segments MSI]
  422. Oct 27 20:18:09 localhost kernel: [ 0.053528] acpi PNP0A08:00: _OSC: platform does not support [PCIeHotplug]
  423. Oct 27 20:18:09 localhost kernel: [ 0.053755] acpi PNP0A08:00: _OSC: OS now controls [PME AER PCIeCapability]
  424. Oct 27 20:18:09 localhost kernel: [ 0.054170] PCI host bridge to bus 0000:00
  425. Oct 27 20:18:09 localhost kernel: [ 0.054173] pci_bus 0000:00: root bus resource [io 0x0000-0x03af window]
  426. Oct 27 20:18:09 localhost kernel: [ 0.054174] pci_bus 0000:00: root bus resource [io 0x03e0-0x0cf7 window]
  427. Oct 27 20:18:09 localhost kernel: [ 0.054175] pci_bus 0000:00: root bus resource [io 0x03b0-0x03df window]
  428. Oct 27 20:18:09 localhost kernel: [ 0.054176] pci_bus 0000:00: root bus resource [io 0x0d00-0xffff window]
  429. Oct 27 20:18:09 localhost kernel: [ 0.054178] pci_bus 0000:00: root bus resource [mem 0x000a0000-0x000bffff window]
  430. Oct 27 20:18:09 localhost kernel: [ 0.054179] pci_bus 0000:00: root bus resource [mem 0x000c0000-0x000dffff window]
  431. Oct 27 20:18:09 localhost kernel: [ 0.054180] pci_bus 0000:00: root bus resource [mem 0xf0000000-0xffffffff window]
  432. Oct 27 20:18:09 localhost kernel: [ 0.054181] pci_bus 0000:00: root bus resource [bus 00-ff]
  433. Oct 27 20:18:09 localhost kernel: [ 0.054189] pci 0000:00:00.0: [8086:0100] type 00 class 0x060000
  434. Oct 27 20:18:09 localhost kernel: [ 0.054291] pci 0000:00:01.0: [8086:0101] type 01 class 0x060400
  435. Oct 27 20:18:09 localhost kernel: [ 0.054328] pci 0000:00:01.0: PME# supported from D0 D3hot D3cold
  436. Oct 27 20:18:09 localhost kernel: [ 0.054459] pci 0000:00:16.0: [8086:1c3a] type 00 class 0x078000
  437. Oct 27 20:18:09 localhost kernel: [ 0.054496] pci 0000:00:16.0: reg 0x10: [mem 0xfb308000-0xfb30800f 64bit]
  438. Oct 27 20:18:09 localhost kernel: [ 0.054604] pci 0000:00:16.0: PME# supported from D0 D3hot D3cold
  439. Oct 27 20:18:09 localhost kernel: [ 0.054707] pci 0000:00:1a.0: [8086:1c2d] type 00 class 0x0c0320
  440. Oct 27 20:18:09 localhost kernel: [ 0.054739] pci 0000:00:1a.0: reg 0x10: [mem 0xfb307000-0xfb3073ff]
  441. Oct 27 20:18:09 localhost kernel: [ 0.054864] pci 0000:00:1a.0: PME# supported from D0 D3hot D3cold
  442. Oct 27 20:18:09 localhost kernel: [ 0.054958] pci 0000:00:1b.0: [8086:1c20] type 00 class 0x040300
  443. Oct 27 20:18:09 localhost kernel: [ 0.054990] pci 0000:00:1b.0: reg 0x10: [mem 0xfb300000-0xfb303fff 64bit]
  444. Oct 27 20:18:09 localhost kernel: [ 0.055104] pci 0000:00:1b.0: PME# supported from D0 D3hot D3cold
  445. Oct 27 20:18:09 localhost kernel: [ 0.055199] pci 0000:00:1c.0: [8086:1c10] type 01 class 0x060400
  446. Oct 27 20:18:09 localhost kernel: [ 0.055325] pci 0000:00:1c.0: PME# supported from D0 D3hot D3cold
  447. Oct 27 20:18:09 localhost kernel: [ 0.055428] pci 0000:00:1c.1: [8086:244e] type 01 class 0x060401
  448. Oct 27 20:18:09 localhost kernel: [ 0.055554] pci 0000:00:1c.1: PME# supported from D0 D3hot D3cold
  449. Oct 27 20:18:09 localhost kernel: [ 0.055654] pci 0000:00:1c.2: [8086:1c14] type 01 class 0x060400
  450. Oct 27 20:18:09 localhost kernel: [ 0.055779] pci 0000:00:1c.2: PME# supported from D0 D3hot D3cold
  451. Oct 27 20:18:09 localhost kernel: [ 0.055887] pci 0000:00:1d.0: [8086:1c26] type 00 class 0x0c0320
  452. Oct 27 20:18:09 localhost kernel: [ 0.055918] pci 0000:00:1d.0: reg 0x10: [mem 0xfb306000-0xfb3063ff]
  453. Oct 27 20:18:09 localhost kernel: [ 0.056044] pci 0000:00:1d.0: PME# supported from D0 D3hot D3cold
  454. Oct 27 20:18:09 localhost kernel: [ 0.056137] pci 0000:00:1f.0: [8086:1c5c] type 00 class 0x060100
  455. Oct 27 20:18:09 localhost kernel: [ 0.056374] pci 0000:00:1f.2: [8086:1c02] type 00 class 0x010601
  456. Oct 27 20:18:09 localhost kernel: [ 0.056403] pci 0000:00:1f.2: reg 0x10: [io 0xf070-0xf077]
  457. Oct 27 20:18:09 localhost kernel: [ 0.056414] pci 0000:00:1f.2: reg 0x14: [io 0xf060-0xf063]
  458. Oct 27 20:18:09 localhost kernel: [ 0.056425] pci 0000:00:1f.2: reg 0x18: [io 0xf050-0xf057]
  459. Oct 27 20:18:09 localhost kernel: [ 0.056437] pci 0000:00:1f.2: reg 0x1c: [io 0xf040-0xf043]
  460. Oct 27 20:18:09 localhost kernel: [ 0.056447] pci 0000:00:1f.2: reg 0x20: [io 0xf020-0xf03f]
  461. Oct 27 20:18:09 localhost kernel: [ 0.056458] pci 0000:00:1f.2: reg 0x24: [mem 0xfb305000-0xfb3057ff]
  462. Oct 27 20:18:09 localhost kernel: [ 0.056524] pci 0000:00:1f.2: PME# supported from D3hot
  463. Oct 27 20:18:09 localhost kernel: [ 0.056609] pci 0000:00:1f.3: [8086:1c22] type 00 class 0x0c0500
  464. Oct 27 20:18:09 localhost kernel: [ 0.056637] pci 0000:00:1f.3: reg 0x10: [mem 0xfb304000-0xfb3040ff 64bit]
  465. Oct 27 20:18:09 localhost kernel: [ 0.056669] pci 0000:00:1f.3: reg 0x20: [io 0xf000-0xf01f]
  466. Oct 27 20:18:09 localhost kernel: [ 0.056808] pci 0000:01:00.0: [10de:1040] type 00 class 0x030000
  467. Oct 27 20:18:09 localhost kernel: [ 0.056823] pci 0000:01:00.0: reg 0x10: [mem 0xfa000000-0xfaffffff]
  468. Oct 27 20:18:09 localhost kernel: [ 0.056832] pci 0000:01:00.0: reg 0x14: [mem 0xf0000000-0xf7ffffff 64bit pref]
  469. Oct 27 20:18:09 localhost kernel: [ 0.056841] pci 0000:01:00.0: reg 0x1c: [mem 0xf8000000-0xf9ffffff 64bit pref]
  470. Oct 27 20:18:09 localhost kernel: [ 0.056847] pci 0000:01:00.0: reg 0x24: [io 0xe000-0xe07f]
  471. Oct 27 20:18:09 localhost kernel: [ 0.056853] pci 0000:01:00.0: reg 0x30: [mem 0xfb000000-0xfb07ffff pref]
  472. Oct 27 20:18:09 localhost kernel: [ 0.056859] pci 0000:01:00.0: enabling Extended Tags
  473. Oct 27 20:18:09 localhost kernel: [ 0.056936] pci 0000:01:00.1: [10de:0e08] type 00 class 0x040300
  474. Oct 27 20:18:09 localhost kernel: [ 0.056949] pci 0000:01:00.1: reg 0x10: [mem 0xfb080000-0xfb083fff]
  475. Oct 27 20:18:09 localhost kernel: [ 0.056983] pci 0000:01:00.1: enabling Extended Tags
  476. Oct 27 20:18:09 localhost kernel: [ 0.057056] pci 0000:00:01.0: PCI bridge to [bus 01]
  477. Oct 27 20:18:09 localhost kernel: [ 0.057059] pci 0000:00:01.0: bridge window [io 0xe000-0xefff]
  478. Oct 27 20:18:09 localhost kernel: [ 0.057061] pci 0000:00:01.0: bridge window [mem 0xfa000000-0xfb0fffff]
  479. Oct 27 20:18:09 localhost kernel: [ 0.057063] pci 0000:00:01.0: bridge window [mem 0xf0000000-0xf9ffffff 64bit pref]
  480. Oct 27 20:18:09 localhost kernel: [ 0.057117] pci 0000:00:1c.0: PCI bridge to [bus 02]
  481. Oct 27 20:18:09 localhost kernel: [ 0.057214] pci 0000:03:00.0: [1b21:1080] type 01 class 0x060401
  482. Oct 27 20:18:09 localhost kernel: [ 0.057402] pci 0000:00:1c.1: PCI bridge to [bus 03-04] (subtractive decode)
  483. Oct 27 20:18:09 localhost kernel: [ 0.057410] pci 0000:00:1c.1: bridge window [mem 0xfb200000-0xfb2fffff]
  484. Oct 27 20:18:09 localhost kernel: [ 0.057417] pci 0000:00:1c.1: bridge window [io 0x0000-0x03af window] (subtractive decode)
  485. Oct 27 20:18:09 localhost kernel: [ 0.057419] pci 0000:00:1c.1: bridge window [io 0x03e0-0x0cf7 window] (subtractive decode)
  486. Oct 27 20:18:09 localhost kernel: [ 0.057420] pci 0000:00:1c.1: bridge window [io 0x03b0-0x03df window] (subtractive decode)
  487. Oct 27 20:18:09 localhost kernel: [ 0.057421] pci 0000:00:1c.1: bridge window [io 0x0d00-0xffff window] (subtractive decode)
  488. Oct 27 20:18:09 localhost kernel: [ 0.057422] pci 0000:00:1c.1: bridge window [mem 0x000a0000-0x000bffff window] (subtractive decode)
  489. Oct 27 20:18:09 localhost kernel: [ 0.057423] pci 0000:00:1c.1: bridge window [mem 0x000c0000-0x000dffff window] (subtractive decode)
  490. Oct 27 20:18:09 localhost kernel: [ 0.057425] pci 0000:00:1c.1: bridge window [mem 0xf0000000-0xffffffff window] (subtractive decode)
  491. Oct 27 20:18:09 localhost kernel: [ 0.057481] pci 0000:04:00.0: [1131:7146] type 00 class 0x048000
  492. Oct 27 20:18:09 localhost kernel: [ 0.057522] pci 0000:04:00.0: reg 0x10: [mem 0xfb201000-0xfb2011ff]
  493. Oct 27 20:18:09 localhost kernel: [ 0.057704] pci 0000:04:01.0: [1131:7146] type 00 class 0x048000
  494. Oct 27 20:18:09 localhost kernel: [ 0.057744] pci 0000:04:01.0: reg 0x10: [mem 0xfb200000-0xfb2001ff]
  495. Oct 27 20:18:09 localhost kernel: [ 0.057998] pci 0000:03:00.0: PCI bridge to [bus 04] (subtractive decode)
  496. Oct 27 20:18:09 localhost kernel: [ 0.058015] pci 0000:03:00.0: bridge window [mem 0xfb200000-0xfb2fffff]
  497. Oct 27 20:18:09 localhost kernel: [ 0.058027] pci 0000:03:00.0: bridge window [mem 0xfb200000-0xfb2fffff] (subtractive decode)
  498. Oct 27 20:18:09 localhost kernel: [ 0.058028] pci 0000:03:00.0: bridge window [io 0x0000-0x03af window] (subtractive decode)
  499. Oct 27 20:18:09 localhost kernel: [ 0.058029] pci 0000:03:00.0: bridge window [io 0x03e0-0x0cf7 window] (subtractive decode)
  500. Oct 27 20:18:09 localhost kernel: [ 0.058030] pci 0000:03:00.0: bridge window [io 0x03b0-0x03df window] (subtractive decode)
  501. Oct 27 20:18:09 localhost kernel: [ 0.058031] pci 0000:03:00.0: bridge window [io 0x0d00-0xffff window] (subtractive decode)
  502. Oct 27 20:18:09 localhost kernel: [ 0.058033] pci 0000:03:00.0: bridge window [mem 0x000a0000-0x000bffff window] (subtractive decode)
  503. Oct 27 20:18:09 localhost kernel: [ 0.058034] pci 0000:03:00.0: bridge window [mem 0x000c0000-0x000dffff window] (subtractive decode)
  504. Oct 27 20:18:09 localhost kernel: [ 0.058035] pci 0000:03:00.0: bridge window [mem 0xf0000000-0xffffffff window] (subtractive decode)
  505. Oct 27 20:18:09 localhost kernel: [ 0.058125] pci 0000:05:00.0: [1969:1083] type 00 class 0x020000
  506. Oct 27 20:18:09 localhost kernel: [ 0.058178] pci 0000:05:00.0: reg 0x10: [mem 0xfb100000-0xfb13ffff 64bit]
  507. Oct 27 20:18:09 localhost kernel: [ 0.058196] pci 0000:05:00.0: reg 0x18: [io 0xd000-0xd07f]
  508. Oct 27 20:18:09 localhost kernel: [ 0.058372] pci 0000:05:00.0: PME# supported from D0 D1 D2 D3hot D3cold
  509. Oct 27 20:18:09 localhost kernel: [ 0.068032] pci 0000:00:1c.2: PCI bridge to [bus 05]
  510. Oct 27 20:18:09 localhost kernel: [ 0.068037] pci 0000:00:1c.2: bridge window [io 0xd000-0xdfff]
  511. Oct 27 20:18:09 localhost kernel: [ 0.068042] pci 0000:00:1c.2: bridge window [mem 0xfb100000-0xfb1fffff]
  512. Oct 27 20:18:09 localhost kernel: [ 0.069034] ACPI: PCI Interrupt Link [LNKA] (IRQs 3 4 5 6 7 10 *11 12 14 15)
  513. Oct 27 20:18:09 localhost kernel: [ 0.069115] ACPI: PCI Interrupt Link [LNKB] (IRQs 3 4 5 6 7 *10 11 12 14 15)
  514. Oct 27 20:18:09 localhost kernel: [ 0.069191] ACPI: PCI Interrupt Link [LNKC] (IRQs *3 4 5 6 10 11 12 14 15)
  515. Oct 27 20:18:09 localhost kernel: [ 0.069266] ACPI: PCI Interrupt Link [LNKD] (IRQs *3 4 5 6 10 11 12 14 15)
  516. Oct 27 20:18:09 localhost kernel: [ 0.069341] ACPI: PCI Interrupt Link [LNKE] (IRQs 3 4 5 6 7 10 11 12 14 15) *0
  517. Oct 27 20:18:09 localhost kernel: [ 0.069417] ACPI: PCI Interrupt Link [LNKF] (IRQs 3 4 5 6 7 10 11 12 14 15) *0
  518. Oct 27 20:18:09 localhost kernel: [ 0.069492] ACPI: PCI Interrupt Link [LNKG] (IRQs *3 4 5 6 7 10 11 12 14 15)
  519. Oct 27 20:18:09 localhost kernel: [ 0.069568] ACPI: PCI Interrupt Link [LNKH] (IRQs *3 4 5 6 7 10 11 12 14 15)
  520. Oct 27 20:18:09 localhost kernel: [ 0.069871] SCSI subsystem initialized
  521. Oct 27 20:18:09 localhost kernel: [ 0.069910] libata version 3.00 loaded.
  522. Oct 27 20:18:09 localhost kernel: [ 0.069910] pci 0000:01:00.0: vgaarb: setting as boot VGA device
  523. Oct 27 20:18:09 localhost kernel: [ 0.069910] pci 0000:01:00.0: vgaarb: VGA device added: decodes=io+mem,owns=io+mem,locks=none
  524. Oct 27 20:18:09 localhost kernel: [ 0.069910] pci 0000:01:00.0: vgaarb: bridge control possible
  525. Oct 27 20:18:09 localhost kernel: [ 0.069910] vgaarb: loaded
  526. Oct 27 20:18:09 localhost kernel: [ 0.069910] ACPI: bus type USB registered
  527. Oct 27 20:18:09 localhost kernel: [ 0.069910] usbcore: registered new interface driver usbfs
  528. Oct 27 20:18:09 localhost kernel: [ 0.069910] usbcore: registered new interface driver hub
  529. Oct 27 20:18:09 localhost kernel: [ 0.069910] usbcore: registered new device driver usb
  530. Oct 27 20:18:09 localhost kernel: [ 0.069910] EDAC MC: Ver: 3.0.0
  531. Oct 27 20:18:09 localhost kernel: [ 0.069910] PCI: Using ACPI for IRQ routing
  532. Oct 27 20:18:09 localhost kernel: [ 0.081129] PCI: pci_cache_line_size set to 64 bytes
  533. Oct 27 20:18:09 localhost kernel: [ 0.081196] e820: reserve RAM buffer [mem 0x0009d800-0x0009ffff]
  534. Oct 27 20:18:09 localhost kernel: [ 0.081197] e820: reserve RAM buffer [mem 0xdf590000-0xdfffffff]
  535. Oct 27 20:18:09 localhost kernel: [ 0.081199] e820: reserve RAM buffer [mem 0xdf60c000-0xdfffffff]
  536. Oct 27 20:18:09 localhost kernel: [ 0.081200] e820: reserve RAM buffer [mem 0xdf800000-0xdfffffff]
  537. Oct 27 20:18:09 localhost kernel: [ 0.081201] e820: reserve RAM buffer [mem 0x11f800000-0x11fffffff]
  538. Oct 27 20:18:09 localhost kernel: [ 0.081295] NetLabel: Initializing
  539. Oct 27 20:18:09 localhost kernel: [ 0.081296] NetLabel: domain hash size = 128
  540. Oct 27 20:18:09 localhost kernel: [ 0.081297] NetLabel: protocols = UNLABELED CIPSOv4 CALIPSO
  541. Oct 27 20:18:09 localhost kernel: [ 0.081314] NetLabel: unlabeled traffic allowed by default
  542. Oct 27 20:18:09 localhost kernel: [ 0.081330] hpet0: at MMIO 0xfed00000, IRQs 2, 8, 0, 0, 0, 0, 0, 0
  543. Oct 27 20:18:09 localhost kernel: [ 0.081330] hpet0: 8 comparators, 64-bit 14.318180 MHz counter
  544. Oct 27 20:18:09 localhost kernel: [ 0.082599] clocksource: Switched to clocksource hpet
  545. Oct 27 20:18:09 localhost kernel: [ 0.091757] VFS: Disk quotas dquot_6.6.0
  546. Oct 27 20:18:09 localhost kernel: [ 0.091775] VFS: Dquot-cache hash table entries: 512 (order 0, 4096 bytes)
  547. Oct 27 20:18:09 localhost kernel: [ 0.091877] AppArmor: AppArmor Filesystem Enabled
  548. Oct 27 20:18:09 localhost kernel: [ 0.091907] pnp: PnP ACPI init
  549. Oct 27 20:18:09 localhost kernel: [ 0.092134] system 00:00: [mem 0xfed10000-0xfed19fff] has been reserved
  550. Oct 27 20:18:09 localhost kernel: [ 0.092135] system 00:00: [mem 0xe0000000-0xefffffff] has been reserved
  551. Oct 27 20:18:09 localhost kernel: [ 0.092137] system 00:00: [mem 0xfed90000-0xfed93fff] has been reserved
  552. Oct 27 20:18:09 localhost kernel: [ 0.092138] system 00:00: [mem 0xfed20000-0xfed3ffff] has been reserved
  553. Oct 27 20:18:09 localhost kernel: [ 0.092139] system 00:00: [mem 0xfee00000-0xfee0ffff] has been reserved
  554. Oct 27 20:18:09 localhost kernel: [ 0.092145] system 00:00: Plug and Play ACPI device, IDs PNP0c01 (active)
  555. Oct 27 20:18:09 localhost kernel: [ 0.092264] system 00:01: [io 0x0290-0x029f] has been reserved
  556. Oct 27 20:18:09 localhost kernel: [ 0.092268] system 00:01: Plug and Play ACPI device, IDs PNP0c02 (active)
  557. Oct 27 20:18:09 localhost kernel: [ 0.092723] pnp 00:02: [dma 3]
  558. Oct 27 20:18:09 localhost kernel: [ 0.092867] pnp 00:02: Plug and Play ACPI device, IDs PNP0401 (active)
  559. Oct 27 20:18:09 localhost kernel: [ 0.093005] pnp 00:03: Plug and Play ACPI device, IDs NTN0530 (active)
  560. Oct 27 20:18:09 localhost kernel: [ 0.093032] pnp 00:04: Plug and Play ACPI device, IDs PNP0b00 (active)
  561. Oct 27 20:18:09 localhost kernel: [ 0.093098] system 00:05: [io 0x04d0-0x04d1] has been reserved
  562. Oct 27 20:18:09 localhost kernel: [ 0.093103] system 00:05: Plug and Play ACPI device, IDs PNP0c02 (active)
  563. Oct 27 20:18:09 localhost kernel: [ 0.093428] pnp 00:06: [dma 0 disabled]
  564. Oct 27 20:18:09 localhost kernel: [ 0.093476] pnp 00:06: Plug and Play ACPI device, IDs PNP0501 (active)
  565. Oct 27 20:18:09 localhost kernel: [ 0.093901] system 00:07: [io 0x0400-0x0453] has been reserved
  566. Oct 27 20:18:09 localhost kernel: [ 0.093903] system 00:07: [io 0x0458-0x047f] has been reserved
  567. Oct 27 20:18:09 localhost kernel: [ 0.093905] system 00:07: [io 0x1180-0x119f] has been reserved
  568. Oct 27 20:18:09 localhost kernel: [ 0.093906] system 00:07: [io 0x0500-0x057f] has been reserved
  569. Oct 27 20:18:09 localhost kernel: [ 0.093908] system 00:07: [mem 0xfed1c000-0xfed1ffff] has been reserved
  570. Oct 27 20:18:09 localhost kernel: [ 0.093910] system 00:07: [mem 0xfec00000-0xfecfffff] could not be reserved
  571. Oct 27 20:18:09 localhost kernel: [ 0.093911] system 00:07: [mem 0xfed08000-0xfed08fff] has been reserved
  572. Oct 27 20:18:09 localhost kernel: [ 0.093913] system 00:07: [mem 0xff000000-0xffffffff] has been reserved
  573. Oct 27 20:18:09 localhost kernel: [ 0.093917] system 00:07: Plug and Play ACPI device, IDs PNP0c01 (active)
  574. Oct 27 20:18:09 localhost kernel: [ 0.093998] system 00:08: [io 0x0454-0x0457] has been reserved
  575. Oct 27 20:18:09 localhost kernel: [ 0.094002] system 00:08: Plug and Play ACPI device, IDs INT3f0d PNP0c02 (active)
  576. Oct 27 20:18:09 localhost kernel: [ 0.094291] pnp: PnP ACPI: found 9 devices
  577. Oct 27 20:18:09 localhost kernel: [ 0.100766] clocksource: acpi_pm: mask: 0xffffff max_cycles: 0xffffff, max_idle_ns: 2085701024 ns
  578. Oct 27 20:18:09 localhost kernel: [ 0.100826] pci 0000:00:01.0: PCI bridge to [bus 01]
  579. Oct 27 20:18:09 localhost kernel: [ 0.100828] pci 0000:00:01.0: bridge window [io 0xe000-0xefff]
  580. Oct 27 20:18:09 localhost kernel: [ 0.100831] pci 0000:00:01.0: bridge window [mem 0xfa000000-0xfb0fffff]
  581. Oct 27 20:18:09 localhost kernel: [ 0.100833] pci 0000:00:01.0: bridge window [mem 0xf0000000-0xf9ffffff 64bit pref]
  582. Oct 27 20:18:09 localhost kernel: [ 0.100836] pci 0000:00:1c.0: PCI bridge to [bus 02]
  583. Oct 27 20:18:09 localhost kernel: [ 0.100852] pci 0000:03:00.0: PCI bridge to [bus 04]
  584. Oct 27 20:18:09 localhost kernel: [ 0.100860] pci 0000:03:00.0: bridge window [mem 0xfb200000-0xfb2fffff]
  585. Oct 27 20:18:09 localhost kernel: [ 0.100877] pci 0000:00:1c.1: PCI bridge to [bus 03-04]
  586. Oct 27 20:18:09 localhost kernel: [ 0.100883] pci 0000:00:1c.1: bridge window [mem 0xfb200000-0xfb2fffff]
  587. Oct 27 20:18:09 localhost kernel: [ 0.100894] pci 0000:00:1c.2: PCI bridge to [bus 05]
  588. Oct 27 20:18:09 localhost kernel: [ 0.100896] pci 0000:00:1c.2: bridge window [io 0xd000-0xdfff]
  589. Oct 27 20:18:09 localhost kernel: [ 0.100902] pci 0000:00:1c.2: bridge window [mem 0xfb100000-0xfb1fffff]
  590. Oct 27 20:18:09 localhost kernel: [ 0.100914] pci_bus 0000:00: resource 4 [io 0x0000-0x03af window]
  591. Oct 27 20:18:09 localhost kernel: [ 0.100915] pci_bus 0000:00: resource 5 [io 0x03e0-0x0cf7 window]
  592. Oct 27 20:18:09 localhost kernel: [ 0.100916] pci_bus 0000:00: resource 6 [io 0x03b0-0x03df window]
  593. Oct 27 20:18:09 localhost kernel: [ 0.100917] pci_bus 0000:00: resource 7 [io 0x0d00-0xffff window]
  594. Oct 27 20:18:09 localhost kernel: [ 0.100919] pci_bus 0000:00: resource 8 [mem 0x000a0000-0x000bffff window]
  595. Oct 27 20:18:09 localhost kernel: [ 0.100920] pci_bus 0000:00: resource 9 [mem 0x000c0000-0x000dffff window]
  596. Oct 27 20:18:09 localhost kernel: [ 0.100921] pci_bus 0000:00: resource 10 [mem 0xf0000000-0xffffffff window]
  597. Oct 27 20:18:09 localhost kernel: [ 0.100922] pci_bus 0000:01: resource 0 [io 0xe000-0xefff]
  598. Oct 27 20:18:09 localhost kernel: [ 0.100924] pci_bus 0000:01: resource 1 [mem 0xfa000000-0xfb0fffff]
  599. Oct 27 20:18:09 localhost kernel: [ 0.100925] pci_bus 0000:01: resource 2 [mem 0xf0000000-0xf9ffffff 64bit pref]
  600. Oct 27 20:18:09 localhost kernel: [ 0.100926] pci_bus 0000:03: resource 1 [mem 0xfb200000-0xfb2fffff]
  601. Oct 27 20:18:09 localhost kernel: [ 0.100927] pci_bus 0000:03: resource 4 [io 0x0000-0x03af window]
  602. Oct 27 20:18:09 localhost kernel: [ 0.100929] pci_bus 0000:03: resource 5 [io 0x03e0-0x0cf7 window]
  603. Oct 27 20:18:09 localhost kernel: [ 0.100930] pci_bus 0000:03: resource 6 [io 0x03b0-0x03df window]
  604. Oct 27 20:18:09 localhost kernel: [ 0.100931] pci_bus 0000:03: resource 7 [io 0x0d00-0xffff window]
  605. Oct 27 20:18:09 localhost kernel: [ 0.100932] pci_bus 0000:03: resource 8 [mem 0x000a0000-0x000bffff window]
  606. Oct 27 20:18:09 localhost kernel: [ 0.100933] pci_bus 0000:03: resource 9 [mem 0x000c0000-0x000dffff window]
  607. Oct 27 20:18:09 localhost kernel: [ 0.100934] pci_bus 0000:03: resource 10 [mem 0xf0000000-0xffffffff window]
  608. Oct 27 20:18:09 localhost kernel: [ 0.100936] pci_bus 0000:04: resource 1 [mem 0xfb200000-0xfb2fffff]
  609. Oct 27 20:18:09 localhost kernel: [ 0.100937] pci_bus 0000:04: resource 4 [mem 0xfb200000-0xfb2fffff]
  610. Oct 27 20:18:09 localhost kernel: [ 0.100938] pci_bus 0000:04: resource 5 [io 0x0000-0x03af window]
  611. Oct 27 20:18:09 localhost kernel: [ 0.100939] pci_bus 0000:04: resource 6 [io 0x03e0-0x0cf7 window]
  612. Oct 27 20:18:09 localhost kernel: [ 0.100940] pci_bus 0000:04: resource 7 [io 0x03b0-0x03df window]
  613. Oct 27 20:18:09 localhost kernel: [ 0.100941] pci_bus 0000:04: resource 8 [io 0x0d00-0xffff window]
  614. Oct 27 20:18:09 localhost kernel: [ 0.100942] pci_bus 0000:04: resource 9 [mem 0x000a0000-0x000bffff window]
  615. Oct 27 20:18:09 localhost kernel: [ 0.100944] pci_bus 0000:04: resource 10 [mem 0x000c0000-0x000dffff window]
  616. Oct 27 20:18:09 localhost kernel: [ 0.100945] pci_bus 0000:04: resource 11 [mem 0xf0000000-0xffffffff window]
  617. Oct 27 20:18:09 localhost kernel: [ 0.100946] pci_bus 0000:05: resource 0 [io 0xd000-0xdfff]
  618. Oct 27 20:18:09 localhost kernel: [ 0.100947] pci_bus 0000:05: resource 1 [mem 0xfb100000-0xfb1fffff]
  619. Oct 27 20:18:09 localhost kernel: [ 0.101048] NET: Registered protocol family 2
  620. Oct 27 20:18:09 localhost kernel: [ 0.101218] TCP established hash table entries: 32768 (order: 6, 262144 bytes)
  621. Oct 27 20:18:09 localhost kernel: [ 0.101292] TCP bind hash table entries: 32768 (order: 7, 524288 bytes)
  622. Oct 27 20:18:09 localhost kernel: [ 0.101395] TCP: Hash tables configured (established 32768 bind 32768)
  623. Oct 27 20:18:09 localhost kernel: [ 0.101427] UDP hash table entries: 2048 (order: 4, 65536 bytes)
  624. Oct 27 20:18:09 localhost kernel: [ 0.101445] UDP-Lite hash table entries: 2048 (order: 4, 65536 bytes)
  625. Oct 27 20:18:09 localhost kernel: [ 0.101491] NET: Registered protocol family 1
  626. Oct 27 20:18:09 localhost kernel: [ 0.160123] pci 0000:01:00.0: Video device with shadowed ROM at [mem 0x000c0000-0x000dffff]
  627. Oct 27 20:18:09 localhost kernel: [ 0.160143] pci 0000:05:00.0: [Firmware Bug]: disabling VPD access (can't determine size of non-standard VPD format)
  628. Oct 27 20:18:09 localhost kernel: [ 0.160147] PCI: CLS 64 bytes, default 64
  629. Oct 27 20:18:09 localhost kernel: [ 0.160194] Unpacking initramfs...
  630. Oct 27 20:18:09 localhost kernel: [ 1.210361] Freeing initrd memory: 68684K
  631. Oct 27 20:18:09 localhost kernel: [ 1.210365] PCI-DMA: Using software bounce buffering for IO (SWIOTLB)
  632. Oct 27 20:18:09 localhost kernel: [ 1.210366] software IO TLB: mapped [mem 0xdb590000-0xdf590000] (64MB)
  633. Oct 27 20:18:09 localhost kernel: [ 1.210630] Scanning for low memory corruption every 60 seconds
  634. Oct 27 20:18:09 localhost kernel: [ 1.211290] Initialise system trusted keyrings
  635. Oct 27 20:18:09 localhost kernel: [ 1.211301] Key type blacklist registered
  636. Oct 27 20:18:09 localhost kernel: [ 1.211331] workingset: timestamp_bits=36 max_order=20 bucket_order=0
  637. Oct 27 20:18:09 localhost kernel: [ 1.212492] zbud: loaded
  638. Oct 27 20:18:09 localhost kernel: [ 1.212991] squashfs: version 4.0 (2009/01/31) Phillip Lougher
  639. Oct 27 20:18:09 localhost kernel: [ 1.213136] fuse init (API version 7.26)
  640. Oct 27 20:18:09 localhost kernel: [ 1.214580] Key type asymmetric registered
  641. Oct 27 20:18:09 localhost kernel: [ 1.214582] Asymmetric key parser 'x509' registered
  642. Oct 27 20:18:09 localhost kernel: [ 1.214613] Block layer SCSI generic (bsg) driver version 0.4 loaded (major 246)
  643. Oct 27 20:18:09 localhost kernel: [ 1.214644] io scheduler noop registered
  644. Oct 27 20:18:09 localhost kernel: [ 1.214645] io scheduler deadline registered
  645. Oct 27 20:18:09 localhost kernel: [ 1.214670] io scheduler cfq registered (default)
  646. Oct 27 20:18:09 localhost kernel: [ 1.215328] pcieport 0000:00:01.0: Signaling PME with IRQ 24
  647. Oct 27 20:18:09 localhost kernel: [ 1.215363] pcieport 0000:00:1c.0: Signaling PME with IRQ 25
  648. Oct 27 20:18:09 localhost kernel: [ 1.215390] pcieport 0000:00:1c.2: Signaling PME with IRQ 26
  649. Oct 27 20:18:09 localhost kernel: [ 1.215456] vesafb: mode is 640x480x32, linelength=2560, pages=0
  650. Oct 27 20:18:09 localhost kernel: [ 1.215457] vesafb: scrolling: redraw
  651. Oct 27 20:18:09 localhost kernel: [ 1.215458] vesafb: Truecolor: size=8:8:8:8, shift=24:16:8:0
  652. Oct 27 20:18:09 localhost kernel: [ 1.215470] vesafb: framebuffer at 0xf9000000, mapped to 0x (ptrval), using 1216k, total 1216k
  653. Oct 27 20:18:09 localhost kernel: [ 1.215563] Console: switching to colour frame buffer device 80x30
  654. Oct 27 20:18:09 localhost kernel: [ 1.215574] fb0: VESA VGA frame buffer device
  655. Oct 27 20:18:09 localhost kernel: [ 1.215589] intel_idle: MWAIT substates: 0x1120
  656. Oct 27 20:18:09 localhost kernel: [ 1.215590] intel_idle: v0.4.1 model 0x2A
  657. Oct 27 20:18:09 localhost kernel: [ 1.215654] intel_idle: lapic_timer_reliable_states 0xffffffff
  658. Oct 27 20:18:09 localhost kernel: [ 1.215744] input: Power Button as /devices/LNXSYSTM:00/LNXSYBUS:00/PNP0C0C:00/input/input0
  659. Oct 27 20:18:09 localhost kernel: [ 1.215753] ACPI: Power Button [PWRB]
  660. Oct 27 20:18:09 localhost kernel: [ 1.215788] input: Power Button as /devices/LNXSYSTM:00/LNXPWRBN:00/input/input1
  661. Oct 27 20:18:09 localhost kernel: [ 1.215816] ACPI: Power Button [PWRF]
  662. Oct 27 20:18:09 localhost kernel: [ 1.216312] Serial: 8250/16550 driver, 32 ports, IRQ sharing enabled
  663. Oct 27 20:18:09 localhost kernel: [ 1.237066] 00:06: ttyS0 at I/O 0x3f8 (irq = 4, base_baud = 115200) is a 16550A
  664. Oct 27 20:18:09 localhost kernel: [ 1.239230] Linux agpgart interface v0.103
  665. Oct 27 20:18:09 localhost kernel: [ 1.240539] loop: module loaded
  666. Oct 27 20:18:09 localhost kernel: [ 1.240717] libphy: Fixed MDIO Bus: probed
  667. Oct 27 20:18:09 localhost kernel: [ 1.240718] tun: Universal TUN/TAP device driver, 1.6
  668. Oct 27 20:18:09 localhost kernel: [ 1.240754] PPP generic driver version 2.4.2
  669. Oct 27 20:18:09 localhost kernel: [ 1.240796] ehci_hcd: USB 2.0 'Enhanced' Host Controller (EHCI) Driver
  670. Oct 27 20:18:09 localhost kernel: [ 1.240798] ehci-pci: EHCI PCI platform driver
  671. Oct 27 20:18:09 localhost kernel: [ 1.240926] ehci-pci 0000:00:1a.0: EHCI Host Controller
  672. Oct 27 20:18:09 localhost kernel: [ 1.240932] ehci-pci 0000:00:1a.0: new USB bus registered, assigned bus number 1
  673. Oct 27 20:18:09 localhost kernel: [ 1.240948] ehci-pci 0000:00:1a.0: debug port 2
  674. Oct 27 20:18:09 localhost kernel: [ 1.244873] ehci-pci 0000:00:1a.0: cache line size of 64 is not supported
  675. Oct 27 20:18:09 localhost kernel: [ 1.244887] ehci-pci 0000:00:1a.0: irq 16, io mem 0xfb307000
  676. Oct 27 20:18:09 localhost kernel: [ 1.260035] ehci-pci 0000:00:1a.0: USB 2.0 started, EHCI 1.00
  677. Oct 27 20:18:09 localhost kernel: [ 1.260102] usb usb1: New USB device found, idVendor=1d6b, idProduct=0002
  678. Oct 27 20:18:09 localhost kernel: [ 1.260103] usb usb1: New USB device strings: Mfr=3, Product=2, SerialNumber=1
  679. Oct 27 20:18:09 localhost kernel: [ 1.260104] usb usb1: Product: EHCI Host Controller
  680. Oct 27 20:18:09 localhost kernel: [ 1.260106] usb usb1: Manufacturer: Linux 4.15.0-66-generic ehci_hcd
  681. Oct 27 20:18:09 localhost kernel: [ 1.260107] usb usb1: SerialNumber: 0000:00:1a.0
  682. Oct 27 20:18:09 localhost kernel: [ 1.260295] hub 1-0:1.0: USB hub found
  683. Oct 27 20:18:09 localhost kernel: [ 1.260303] hub 1-0:1.0: 2 ports detected
  684. Oct 27 20:18:09 localhost kernel: [ 1.260518] ehci-pci 0000:00:1d.0: EHCI Host Controller
  685. Oct 27 20:18:09 localhost kernel: [ 1.260525] ehci-pci 0000:00:1d.0: new USB bus registered, assigned bus number 2
  686. Oct 27 20:18:09 localhost kernel: [ 1.260539] ehci-pci 0000:00:1d.0: debug port 2
  687. Oct 27 20:18:09 localhost kernel: [ 1.264437] ehci-pci 0000:00:1d.0: cache line size of 64 is not supported
  688. Oct 27 20:18:09 localhost kernel: [ 1.264449] ehci-pci 0000:00:1d.0: irq 23, io mem 0xfb306000
  689. Oct 27 20:18:09 localhost kernel: [ 1.280043] ehci-pci 0000:00:1d.0: USB 2.0 started, EHCI 1.00
  690. Oct 27 20:18:09 localhost kernel: [ 1.280097] usb usb2: New USB device found, idVendor=1d6b, idProduct=0002
  691. Oct 27 20:18:09 localhost kernel: [ 1.280099] usb usb2: New USB device strings: Mfr=3, Product=2, SerialNumber=1
  692. Oct 27 20:18:09 localhost kernel: [ 1.280100] usb usb2: Product: EHCI Host Controller
  693. Oct 27 20:18:09 localhost kernel: [ 1.280101] usb usb2: Manufacturer: Linux 4.15.0-66-generic ehci_hcd
  694. Oct 27 20:18:09 localhost kernel: [ 1.280102] usb usb2: SerialNumber: 0000:00:1d.0
  695. Oct 27 20:18:09 localhost kernel: [ 1.280277] hub 2-0:1.0: USB hub found
  696. Oct 27 20:18:09 localhost kernel: [ 1.280284] hub 2-0:1.0: 2 ports detected
  697. Oct 27 20:18:09 localhost kernel: [ 1.280401] ehci-platform: EHCI generic platform driver
  698. Oct 27 20:18:09 localhost kernel: [ 1.280412] ohci_hcd: USB 1.1 'Open' Host Controller (OHCI) Driver
  699. Oct 27 20:18:09 localhost kernel: [ 1.280415] ohci-pci: OHCI PCI platform driver
  700. Oct 27 20:18:09 localhost kernel: [ 1.280423] ohci-platform: OHCI generic platform driver
  701. Oct 27 20:18:09 localhost kernel: [ 1.280429] uhci_hcd: USB Universal Host Controller Interface driver
  702. Oct 27 20:18:09 localhost kernel: [ 1.280480] i8042: PNP: No PS/2 controller found.
  703. Oct 27 20:18:09 localhost kernel: [ 1.280699] mousedev: PS/2 mouse device common for all mice
  704. Oct 27 20:18:09 localhost kernel: [ 1.281024] rtc_cmos 00:04: RTC can wake from S4
  705. Oct 27 20:18:09 localhost kernel: [ 1.281191] rtc_cmos 00:04: rtc core: registered rtc_cmos as rtc0
  706. Oct 27 20:18:09 localhost kernel: [ 1.281224] rtc_cmos 00:04: alarms up to one month, y3k, 114 bytes nvram, hpet irqs
  707. Oct 27 20:18:09 localhost kernel: [ 1.281231] i2c /dev entries driver
  708. Oct 27 20:18:09 localhost kernel: [ 1.281281] device-mapper: uevent: version 1.0.3
  709. Oct 27 20:18:09 localhost kernel: [ 1.281386] device-mapper: ioctl: 4.37.0-ioctl (2017-09-20) initialised: dm-devel@redhat.com
  710. Oct 27 20:18:09 localhost kernel: [ 1.281391] intel_pstate: Intel P-state driver initializing
  711. Oct 27 20:18:09 localhost kernel: [ 1.281492] ledtrig-cpu: registered to indicate activity on CPUs
  712. Oct 27 20:18:09 localhost kernel: [ 1.281859] NET: Registered protocol family 10
  713. Oct 27 20:18:09 localhost kernel: [ 1.286441] Segment Routing with IPv6
  714. Oct 27 20:18:09 localhost kernel: [ 1.286470] NET: Registered protocol family 17
  715. Oct 27 20:18:09 localhost kernel: [ 1.286512] Key type dns_resolver registered
  716. Oct 27 20:18:09 localhost kernel: [ 1.286685] mce: Using 7 MCE banks
  717. Oct 27 20:18:09 localhost kernel: [ 1.286696] RAS: Correctable Errors collector initialized.
  718. Oct 27 20:18:09 localhost kernel: [ 1.286731] microcode: sig=0x206a7, pf=0x2, revision=0x2f
  719. Oct 27 20:18:09 localhost kernel: [ 1.286775] microcode: Microcode Update Driver: v2.2.
  720. Oct 27 20:18:09 localhost kernel: [ 1.286788] sched_clock: Marking stable (1286771196, 0)->(1269215103, 17556093)
  721. Oct 27 20:18:09 localhost kernel: [ 1.286972] registered taskstats version 1
  722. Oct 27 20:18:09 localhost kernel: [ 1.286981] Loading compiled-in X.509 certificates
  723. Oct 27 20:18:09 localhost kernel: [ 1.289980] Loaded X.509 cert 'Build time autogenerated kernel key: 01a66adcc10ca4ce7676a3458c33483b0e2b806e'
  724. Oct 27 20:18:09 localhost kernel: [ 1.290006] zswap: loaded using pool lzo/zbud
  725. Oct 27 20:18:09 localhost kernel: [ 1.293981] Key type big_key registered
  726. Oct 27 20:18:09 localhost kernel: [ 1.293986] Key type trusted registered
  727. Oct 27 20:18:09 localhost kernel: [ 1.295910] Key type encrypted registered
  728. Oct 27 20:18:09 localhost kernel: [ 1.295914] AppArmor: AppArmor sha1 policy hashing enabled
  729. Oct 27 20:18:09 localhost kernel: [ 1.295917] ima: No TPM chip found, activating TPM-bypass! (rc=-19)
  730. Oct 27 20:18:09 localhost kernel: [ 1.295922] ima: Allocated hash algorithm: sha1
  731. Oct 27 20:18:09 localhost kernel: [ 1.295939] evm: HMAC attrs: 0x1
  732. Oct 27 20:18:09 localhost kernel: [ 1.296231] Magic number: 7:342:345
  733. Oct 27 20:18:09 localhost kernel: [ 1.296256] tty tty62: hash matches
  734. Oct 27 20:18:09 localhost kernel: [ 1.296348] rtc_cmos 00:04: setting system clock to 2019-10-27 19:18:02 UTC (1572203882)
  735. Oct 27 20:18:09 localhost kernel: [ 1.296431] BIOS EDD facility v0.16 2004-Jun-25, 0 devices found
  736. Oct 27 20:18:09 localhost kernel: [ 1.296431] EDD information not available.
  737. Oct 27 20:18:09 localhost kernel: [ 1.299024] Freeing unused kernel image memory: 2436K
  738. Oct 27 20:18:09 localhost kernel: [ 1.316034] Write protecting the kernel read-only data: 20480k
  739. Oct 27 20:18:09 localhost kernel: [ 1.316710] Freeing unused kernel image memory: 2008K
  740. Oct 27 20:18:09 localhost kernel: [ 1.317144] Freeing unused kernel image memory: 1884K
  741. Oct 27 20:18:09 localhost kernel: [ 1.326504] x86/mm: Checked W+X mappings: passed, no W+X pages found.
  742. Oct 27 20:18:09 localhost kernel: [ 1.326506] x86/mm: Checking user space page tables
  743. Oct 27 20:18:09 localhost kernel: [ 1.335430] x86/mm: Checked W+X mappings: passed, no W+X pages found.
  744. Oct 27 20:18:09 localhost kernel: [ 1.432505] ipmi message handler version 39.2
  745. Oct 27 20:18:09 localhost kernel: [ 1.433864] ipmi device interface
  746. Oct 27 20:18:09 localhost kernel: [ 1.440458] ahci 0000:00:1f.2: version 3.0
  747. Oct 27 20:18:09 localhost kernel: [ 1.450781] ahci 0000:00:1f.2: AHCI 0001.0300 32 slots 4 ports 3 Gbps 0x33 impl SATA mode
  748. Oct 27 20:18:09 localhost kernel: [ 1.450784] ahci 0000:00:1f.2: flags: 64bit ncq sntf pm led clo pio slum part ems apst
  749. Oct 27 20:18:09 localhost kernel: [ 1.460450] nvidia: loading out-of-tree module taints kernel.
  750. Oct 27 20:18:09 localhost kernel: [ 1.460460] nvidia: module license 'NVIDIA' taints kernel.
  751. Oct 27 20:18:09 localhost kernel: [ 1.460461] Disabling lock debugging due to kernel taint
  752. Oct 27 20:18:09 localhost kernel: [ 1.473410] atl1c 0000:05:00.0: version 1.0.1.1-NAPI
  753. Oct 27 20:18:09 localhost kernel: [ 1.474252] nvidia: module verification failed: signature and/or required key missing - tainting kernel
  754. Oct 27 20:18:09 localhost kernel: [ 1.481614] nvidia-nvlink: Nvlink Core is being initialized, major device number 243
  755. Oct 27 20:18:09 localhost kernel: [ 1.481927] nvidia 0000:01:00.0: vgaarb: changed VGA decodes: olddecodes=io+mem,decodes=none:owns=io+mem
  756. Oct 27 20:18:09 localhost kernel: [ 1.485365] NVRM: loading NVIDIA UNIX x86_64 Kernel Module 390.116 Sun Jan 27 07:21:36 PST 2019 (using threaded interrupts)
  757. Oct 27 20:18:09 localhost kernel: [ 1.492082] scsi host0: ahci
  758. Oct 27 20:18:09 localhost kernel: [ 1.500220] scsi host1: ahci
  759. Oct 27 20:18:09 localhost kernel: [ 1.502757] scsi host2: ahci
  760. Oct 27 20:18:09 localhost kernel: [ 1.503056] scsi host3: ahci
  761. Oct 27 20:18:09 localhost kernel: [ 1.504743] nvidia-modeset: Loading NVIDIA Kernel Mode Setting Driver for UNIX platforms 390.116 Sun Jan 27 06:30:32 PST 2019
  762. Oct 27 20:18:09 localhost kernel: [ 1.505517] [drm] [nvidia-drm] [GPU ID 0x00000100] Loading driver
  763. Oct 27 20:18:09 localhost kernel: [ 1.505519] [drm] Initialized nvidia-drm 0.0.0 20160202 for 0000:01:00.0 on minor 0
  764. Oct 27 20:18:09 localhost kernel: [ 1.509517] atl1c 0000:05:00.0 enp5s0: renamed from eth0
  765. Oct 27 20:18:09 localhost kernel: [ 1.510410] scsi host4: ahci
  766. Oct 27 20:18:09 localhost kernel: [ 1.510817] scsi host5: ahci
  767. Oct 27 20:18:09 localhost kernel: [ 1.510874] ata1: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305100 irq 27
  768. Oct 27 20:18:09 localhost kernel: [ 1.510877] ata2: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305180 irq 27
  769. Oct 27 20:18:09 localhost kernel: [ 1.510877] ata3: DUMMY
  770. Oct 27 20:18:09 localhost kernel: [ 1.510878] ata4: DUMMY
  771. Oct 27 20:18:09 localhost kernel: [ 1.510881] ata5: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305300 irq 27
  772. Oct 27 20:18:09 localhost kernel: [ 1.510883] ata6: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305380 irq 27
  773. Oct 27 20:18:09 localhost kernel: [ 1.596039] usb 1-1: new high-speed USB device number 2 using ehci-pci
  774. Oct 27 20:18:09 localhost kernel: [ 1.616038] usb 2-1: new high-speed USB device number 2 using ehci-pci
  775. Oct 27 20:18:09 localhost kernel: [ 1.752509] usb 1-1: New USB device found, idVendor=8087, idProduct=0024
  776. Oct 27 20:18:09 localhost kernel: [ 1.752511] usb 1-1: New USB device strings: Mfr=0, Product=0, SerialNumber=0
  777. Oct 27 20:18:09 localhost kernel: [ 1.752863] hub 1-1:1.0: USB hub found
  778. Oct 27 20:18:09 localhost kernel: [ 1.752956] hub 1-1:1.0: 4 ports detected
  779. Oct 27 20:18:09 localhost kernel: [ 1.772475] usb 2-1: New USB device found, idVendor=8087, idProduct=0024
  780. Oct 27 20:18:09 localhost kernel: [ 1.772478] usb 2-1: New USB device strings: Mfr=0, Product=0, SerialNumber=0
  781. Oct 27 20:18:09 localhost kernel: [ 1.772752] hub 2-1:1.0: USB hub found
  782. Oct 27 20:18:09 localhost kernel: [ 1.772805] hub 2-1:1.0: 6 ports detected
  783. Oct 27 20:18:09 localhost kernel: [ 1.826635] ata1: SATA link up 3.0 Gbps (SStatus 123 SControl 300)
  784. Oct 27 20:18:09 localhost kernel: [ 1.826666] ata2: SATA link up 3.0 Gbps (SStatus 123 SControl 300)
  785. Oct 27 20:18:09 localhost kernel: [ 1.826683] ata5: SATA link up 1.5 Gbps (SStatus 113 SControl 300)
  786. Oct 27 20:18:09 localhost kernel: [ 1.826700] ata6: SATA link down (SStatus 0 SControl 300)
  787. Oct 27 20:18:09 localhost kernel: [ 1.827295] ata1.00: ATA-9: WDC WD30EFRX-68AX9N0, 80.00A80, max UDMA/133
  788. Oct 27 20:18:09 localhost kernel: [ 1.827298] ata1.00: 5860533168 sectors, multi 16: LBA48 NCQ (depth 31/32), AA
  789. Oct 27 20:18:09 localhost kernel: [ 1.828048] ata1.00: configured for UDMA/133
  790. Oct 27 20:18:09 localhost kernel: [ 1.828330] scsi 0:0:0:0: Direct-Access ATA WDC WD30EFRX-68A 0A80 PQ: 0 ANSI: 5
  791. Oct 27 20:18:09 localhost kernel: [ 1.828584] sd 0:0:0:0: Attached scsi generic sg0 type 0
  792. Oct 27 20:18:09 localhost kernel: [ 1.828691] sd 0:0:0:0: [sda] 5860533168 512-byte logical blocks: (3.00 TB/2.73 TiB)
  793. Oct 27 20:18:09 localhost kernel: [ 1.828693] sd 0:0:0:0: [sda] 4096-byte physical blocks
  794. Oct 27 20:18:09 localhost kernel: [ 1.828704] sd 0:0:0:0: [sda] Write Protect is off
  795. Oct 27 20:18:09 localhost kernel: [ 1.828706] sd 0:0:0:0: [sda] Mode Sense: 00 3a 00 00
  796. Oct 27 20:18:09 localhost kernel: [ 1.828726] sd 0:0:0:0: [sda] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA
  797. Oct 27 20:18:09 localhost kernel: [ 1.829126] ata5.00: ATAPI: ATAPI iHAS122, ZL0F, max UDMA/100
  798. Oct 27 20:18:09 localhost kernel: [ 1.829912] ata5.00: configured for UDMA/100
  799. Oct 27 20:18:09 localhost kernel: [ 1.833456] ata2.00: ATA-10: KINGSTON SA400S37120G, R0105A, max UDMA/133
  800. Oct 27 20:18:09 localhost kernel: [ 1.833459] ata2.00: 234441648 sectors, multi 1: LBA48 NCQ (depth 31/32), AA
  801. Oct 27 20:18:09 localhost kernel: [ 1.844050] ata2.00: configured for UDMA/133
  802. Oct 27 20:18:09 localhost kernel: [ 1.844338] scsi 1:0:0:0: Direct-Access ATA KINGSTON SA400S3 5A PQ: 0 ANSI: 5
  803. Oct 27 20:18:09 localhost kernel: [ 1.844679] sd 1:0:0:0: Attached scsi generic sg1 type 0
  804. Oct 27 20:18:09 localhost kernel: [ 1.844882] sd 1:0:0:0: [sdb] 234441648 512-byte logical blocks: (120 GB/112 GiB)
  805. Oct 27 20:18:09 localhost kernel: [ 1.844889] sd 1:0:0:0: [sdb] Write Protect is off
  806. Oct 27 20:18:09 localhost kernel: [ 1.844891] sd 1:0:0:0: [sdb] Mode Sense: 00 3a 00 00
  807. Oct 27 20:18:09 localhost kernel: [ 1.844904] sd 1:0:0:0: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA
  808. Oct 27 20:18:09 localhost kernel: [ 1.845676] sdb: sdb1 sdb2
  809. Oct 27 20:18:09 localhost kernel: [ 1.846126] sd 1:0:0:0: [sdb] Attached SCSI disk
  810. Oct 27 20:18:09 localhost kernel: [ 1.848171] scsi 4:0:0:0: CD-ROM ATAPI iHAS122 ZL0F PQ: 0 ANSI: 5
  811. Oct 27 20:18:09 localhost kernel: [ 1.877895] sda: sda1 sda2 sda3 sda4 sda5 sda6
  812. Oct 27 20:18:09 localhost kernel: [ 1.878396] sd 0:0:0:0: [sda] Attached SCSI disk
  813. Oct 27 20:18:09 localhost kernel: [ 1.924823] sr 4:0:0:0: [sr0] scsi3-mmc drive: 48x/48x writer dvd-ram cd/rw xa/form2 cdda tray
  814. Oct 27 20:18:09 localhost kernel: [ 1.924825] cdrom: Uniform CD-ROM driver Revision: 3.20
  815. Oct 27 20:18:09 localhost kernel: [ 1.924938] sr 4:0:0:0: Attached scsi CD-ROM sr0
  816. Oct 27 20:18:09 localhost kernel: [ 1.924992] sr 4:0:0:0: Attached scsi generic sg2 type 5
  817. Oct 27 20:18:09 localhost kernel: [ 2.040051] usb 1-1.1: new full-speed USB device number 3 using ehci-pci
  818. Oct 27 20:18:09 localhost kernel: [ 2.060043] usb 2-1.2: new high-speed USB device number 3 using ehci-pci
  819. Oct 27 20:18:09 localhost kernel: [ 2.150058] usb 1-1.1: New USB device found, idVendor=0403, idProduct=6001
  820. Oct 27 20:18:09 localhost kernel: [ 2.150061] usb 1-1.1: New USB device strings: Mfr=0, Product=0, SerialNumber=3
  821. Oct 27 20:18:09 localhost kernel: [ 2.150062] usb 1-1.1: SerialNumber: Reader 3FB4612
  822. Oct 27 20:18:09 localhost kernel: [ 2.150302] random: fast init done
  823. Oct 27 20:18:09 localhost kernel: [ 2.150365] random: systemd-udevd: uninitialized urandom read (16 bytes read)
  824. Oct 27 20:18:09 localhost kernel: [ 2.150372] random: systemd-udevd: uninitialized urandom read (16 bytes read)
  825. Oct 27 20:18:09 localhost kernel: [ 2.150589] random: systemd-udevd: uninitialized urandom read (16 bytes read)
  826. Oct 27 20:18:09 localhost kernel: [ 2.168933] usb 2-1.2: New USB device found, idVendor=0781, idProduct=5571
  827. Oct 27 20:18:09 localhost kernel: [ 2.168935] usb 2-1.2: New USB device strings: Mfr=1, Product=2, SerialNumber=3
  828. Oct 27 20:18:09 localhost kernel: [ 2.168936] usb 2-1.2: Product: Cruzer Fit
  829. Oct 27 20:18:09 localhost kernel: [ 2.168937] usb 2-1.2: Manufacturer: SanDisk
  830. Oct 27 20:18:09 localhost kernel: [ 2.168939] usb 2-1.2: SerialNumber: 4C530010201112117272
  831. Oct 27 20:18:09 localhost kernel: [ 2.172610] usb-storage 2-1.2:1.0: USB Mass Storage device detected
  832. Oct 27 20:18:09 localhost kernel: [ 2.172711] scsi host6: usb-storage 2-1.2:1.0
  833. Oct 27 20:18:09 localhost kernel: [ 2.172781] usbcore: registered new interface driver usb-storage
  834. Oct 27 20:18:09 localhost kernel: [ 2.174177] usbcore: registered new interface driver uas
  835. Oct 27 20:18:09 localhost kernel: [ 2.236036] tsc: Refined TSC clocksource calibration: 2394.559 MHz
  836. Oct 27 20:18:09 localhost kernel: [ 2.236045] clocksource: tsc: mask: 0xffffffffffffffff max_cycles: 0x2284235ba97, max_idle_ns: 440795203400 ns
  837. Oct 27 20:18:09 localhost kernel: [ 2.248043] usb 2-1.5: new low-speed USB device number 4 using ehci-pci
  838. Oct 27 20:18:09 localhost kernel: [ 2.363838] usb 2-1.5: New USB device found, idVendor=046a, idProduct=b090
  839. Oct 27 20:18:09 localhost kernel: [ 2.363841] usb 2-1.5: New USB device strings: Mfr=1, Product=2, SerialNumber=0
  840. Oct 27 20:18:09 localhost kernel: [ 2.363842] usb 2-1.5: Product: USB keyboard
  841. Oct 27 20:18:09 localhost kernel: [ 2.363843] usb 2-1.5: Manufacturer: Cherry
  842. Oct 27 20:18:09 localhost kernel: [ 2.367911] hidraw: raw HID events driver (C) Jiri Kosina
  843. Oct 27 20:18:09 localhost kernel: [ 2.379215] usbcore: registered new interface driver usbhid
  844. Oct 27 20:18:09 localhost kernel: [ 2.379217] usbhid: USB HID core driver
  845. Oct 27 20:18:09 localhost kernel: [ 2.381534] input: Cherry USB keyboard as /devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.5/2-1.5:1.0/0003:046A:B090.0001/input/input2
  846. Oct 27 20:18:09 localhost kernel: [ 2.440296] hid-generic 0003:046A:B090.0001: input,hidraw0: USB HID v1.11 Keyboard [Cherry USB keyboard] on usb-0000:00:1d.0-1.5/input0
  847. Oct 27 20:18:09 localhost kernel: [ 2.440453] input: Cherry USB keyboard as /devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.5/2-1.5:1.1/0003:046A:B090.0002/input/input3
  848. Oct 27 20:18:09 localhost kernel: [ 2.500506] hid-generic 0003:046A:B090.0002: input,hiddev0,hidraw1: USB HID v1.11 Device [Cherry USB keyboard] on usb-0000:00:1d.0-1.5/input1
  849. Oct 27 20:18:09 localhost kernel: [ 2.980021] raid6: sse2x1 gen() 7071 MB/s
  850. Oct 27 20:18:09 localhost kernel: [ 3.028021] raid6: sse2x1 xor() 4844 MB/s
  851. Oct 27 20:18:09 localhost kernel: [ 3.076019] raid6: sse2x2 gen() 8296 MB/s
  852. Oct 27 20:18:09 localhost kernel: [ 3.124023] raid6: sse2x2 xor() 5612 MB/s
  853. Oct 27 20:18:09 localhost kernel: [ 3.172017] raid6: sse2x4 gen() 9881 MB/s
  854. Oct 27 20:18:09 localhost kernel: [ 3.196729] scsi 6:0:0:0: Direct-Access SanDisk Cruzer Fit 1.27 PQ: 0 ANSI: 6
  855. Oct 27 20:18:09 localhost kernel: [ 3.197020] sd 6:0:0:0: Attached scsi generic sg3 type 0
  856. Oct 27 20:18:09 localhost kernel: [ 3.197689] sd 6:0:0:0: [sdc] 31266816 512-byte logical blocks: (16.0 GB/14.9 GiB)
  857. Oct 27 20:18:09 localhost kernel: [ 3.198689] sd 6:0:0:0: [sdc] Write Protect is off
  858. Oct 27 20:18:09 localhost kernel: [ 3.198691] sd 6:0:0:0: [sdc] Mode Sense: 43 00 00 00
  859. Oct 27 20:18:09 localhost kernel: [ 3.199696] sd 6:0:0:0: [sdc] Write cache: disabled, read cache: enabled, doesn't support DPO or FUA
  860. Oct 27 20:18:09 localhost kernel: [ 3.203955] sdc: sdc1 sdc2 sdc3
  861. Oct 27 20:18:09 localhost kernel: [ 3.206819] sd 6:0:0:0: [sdc] Attached SCSI disk
  862. Oct 27 20:18:09 localhost kernel: [ 3.220022] raid6: sse2x4 xor() 6503 MB/s
  863. Oct 27 20:18:09 localhost kernel: [ 3.220024] raid6: using algorithm sse2x4 gen() 9881 MB/s
  864. Oct 27 20:18:09 localhost kernel: [ 3.220024] raid6: .... xor() 6503 MB/s, rmw enabled
  865. Oct 27 20:18:09 localhost kernel: [ 3.220026] raid6: using ssse3x2 recovery algorithm
  866. Oct 27 20:18:09 localhost kernel: [ 3.221497] xor: measuring software checksum speed
  867. Oct 27 20:18:09 localhost kernel: [ 3.260019] prefetch64-sse: 12693.000 MB/sec
  868. Oct 27 20:18:09 localhost kernel: [ 3.300017] generic_sse: 11716.000 MB/sec
  869. Oct 27 20:18:09 localhost kernel: [ 3.300018] xor: using function: prefetch64-sse (12693.000 MB/sec)
  870. Oct 27 20:18:09 localhost kernel: [ 3.300039] clocksource: Switched to clocksource tsc
  871. Oct 27 20:18:09 localhost kernel: [ 3.301379] async_tx: api initialized (async)
  872. Oct 27 20:18:09 localhost kernel: [ 3.366090] Btrfs loaded, crc32c=crc32c-intel
  873. Oct 27 20:18:09 localhost kernel: [ 4.087743] EXT4-fs (sdb1): mounted filesystem with ordered data mode. Opts: (null)
  874. Oct 27 20:18:09 localhost kernel: [ 4.289987] ip_tables: (C) 2000-2006 Netfilter Core Team
  875. Oct 27 20:18:09 localhost kernel: [ 4.298348] systemd[1]: systemd 237 running in system mode. (+PAM +AUDIT +SELINUX +IMA +APPARMOR +SMACK +SYSVINIT +UTMP +LIBCRYPTSETUP +GCRYPT +GNUTLS +ACL +XZ +LZ4 +SECCOMP +BLKID +ELFUTILS +KMOD -IDN2 +IDN -PCRE2 default-hierarchy=hybrid)
  876. Oct 27 20:18:09 localhost kernel: [ 4.316149] systemd[1]: Detected architecture x86-64.
  877. Oct 27 20:18:09 localhost kernel: [ 4.318067] systemd[1]: Set hostname to <myVDR>.
  878. Oct 27 20:18:09 localhost kernel: [ 4.494670] systemd[1]: vdr-addon-lifeguard-ng.service: Service has a D-Bus service name specified, but is not of type dbus. Ignoring.
  879. Oct 27 20:18:09 localhost kernel: [ 4.539466] systemd[1]: Reached target User and Group Name Lookups.
  880. Oct 27 20:18:09 localhost kernel: [ 4.540332] systemd[1]: Created slice User and Session Slice.
  881. Oct 27 20:18:09 localhost kernel: [ 4.540555] systemd[1]: Set up automount Arbitrary Executable File Formats File System Automount Point.
  882. Oct 27 20:18:09 localhost kernel: [ 4.540620] systemd[1]: Started Forward Password Requests to Wall Directory Watch.
  883. Oct 27 20:18:09 localhost kernel: [ 4.540983] systemd[1]: Created slice System Slice.
  884. Oct 27 20:18:09 localhost kernel: [ 4.541078] systemd[1]: Listening on RPCbind Server Activation Socket.
  885. Oct 27 20:18:09 localhost kernel: [ 4.594116] Loading iSCSI transport class v2.0-870.
  886. Oct 27 20:18:09 localhost kernel: [ 4.600956] iscsi: registered transport (tcp)
  887. Oct 27 20:18:09 localhost kernel: [ 4.617375] EXT4-fs (sdb1): re-mounted. Opts: errors=remount-ro
  888. Oct 27 20:18:09 localhost kernel: [ 4.655330] iscsi: registered transport (iser)
  889. Oct 27 20:18:09 localhost kernel: [ 4.742006] systemd-journald[393]: Received request to flush runtime journal from PID 1
  890. Oct 27 20:18:09 localhost kernel: [ 4.764199] RPC: Registered named UNIX socket transport module.
  891. Oct 27 20:18:09 localhost kernel: [ 4.764200] RPC: Registered udp transport module.
  892. Oct 27 20:18:09 localhost kernel: [ 4.764201] RPC: Registered tcp transport module.
  893. Oct 27 20:18:09 localhost kernel: [ 4.764202] RPC: Registered tcp NFSv4.1 backchannel transport module.
  894. Oct 27 20:18:09 localhost kernel: [ 4.771201] random: crng init done
  895. Oct 27 20:18:09 localhost kernel: [ 4.771204] random: 7 urandom warning(s) missed due to ratelimiting
  896. Oct 27 20:18:09 localhost kernel: [ 4.824882] Installing knfsd (copyright (C) 1996 okir@monad.swb.de).
  897. Oct 27 20:18:09 localhost kernel: [ 5.118682] systemd-journald[393]: File /var/log/journal/5f8468ca6e4c430ab172e3c83e833eaf/system.journal corrupted or uncleanly shut down, renaming and replacing.
  898. Oct 27 20:18:09 localhost kernel: [ 5.563978] ACPI Warning: SystemIO range 0x0000000000000540-0x000000000000054F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  899. Oct 27 20:18:09 localhost kernel: [ 5.563984] ACPI Warning: SystemIO range 0x0000000000000540-0x000000000000054F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  900. Oct 27 20:18:09 localhost kernel: [ 5.563988] ACPI: If an ACPI driver is available for this device, you should use it instead of the native driver
  901. Oct 27 20:18:09 localhost kernel: [ 5.563989] ACPI Warning: SystemIO range 0x0000000000000530-0x000000000000053F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  902. Oct 27 20:18:09 localhost kernel: [ 5.563992] ACPI Warning: SystemIO range 0x0000000000000530-0x000000000000053F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  903. Oct 27 20:18:09 localhost kernel: [ 5.563995] ACPI: If an ACPI driver is available for this device, you should use it instead of the native driver
  904. Oct 27 20:18:09 localhost kernel: [ 5.563996] ACPI Warning: SystemIO range 0x0000000000000500-0x000000000000052F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  905. Oct 27 20:18:09 localhost kernel: [ 5.563999] ACPI Warning: SystemIO range 0x0000000000000500-0x000000000000052F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  906. Oct 27 20:18:09 localhost kernel: [ 5.564002] ACPI: If an ACPI driver is available for this device, you should use it instead of the native driver
  907. Oct 27 20:18:09 localhost kernel: [ 5.564002] lpc_ich: Resource conflict(s) found affecting gpio_ich
  908. Oct 27 20:18:09 localhost kernel: [ 5.574915] shpchp: Standard Hot Plug PCI Controller Driver version: 0.4
  909. Oct 27 20:18:09 localhost kernel: [ 5.696632] parport_pc 00:02: reported by Plug and Play ACPI
  910. Oct 27 20:18:09 localhost kernel: [ 5.696722] parport0: PC-style at 0x378 (0x778), irq 5, dma 3 [PCSPP,TRISTATE,COMPAT,EPP,ECP,DMA]
  911. Oct 27 20:18:09 localhost kernel: [ 5.703762] nvidia-uvm: Loaded the UVM driver in 8 mode, major device number 240
  912. Oct 27 20:18:09 localhost kernel: [ 5.780970] snd_hda_intel 0000:01:00.1: Disabling MSI
  913. Oct 27 20:18:09 localhost kernel: [ 5.780977] snd_hda_intel 0000:01:00.1: Handle vga_switcheroo audio client
  914. Oct 27 20:18:09 localhost kernel: [ 5.781544] snd_hda_codec_realtek hdaudioC0D0: autoconfig for ALC887-VD: line_outs=3 (0x14/0x15/0x16/0x0/0x0) type:line
  915. Oct 27 20:18:09 localhost kernel: [ 5.781547] snd_hda_codec_realtek hdaudioC0D0: speaker_outs=0 (0x0/0x0/0x0/0x0/0x0)
  916. Oct 27 20:18:09 localhost kernel: [ 5.781548] snd_hda_codec_realtek hdaudioC0D0: hp_outs=1 (0x1b/0x0/0x0/0x0/0x0)
  917. Oct 27 20:18:09 localhost kernel: [ 5.781549] snd_hda_codec_realtek hdaudioC0D0: mono: mono_out=0x0
  918. Oct 27 20:18:09 localhost kernel: [ 5.781550] snd_hda_codec_realtek hdaudioC0D0: dig-out=0x1e/0x0
  919. Oct 27 20:18:09 localhost kernel: [ 5.781551] snd_hda_codec_realtek hdaudioC0D0: inputs:
  920. Oct 27 20:18:09 localhost kernel: [ 5.781553] snd_hda_codec_realtek hdaudioC0D0: Front Mic=0x19
  921. Oct 27 20:18:09 localhost kernel: [ 5.781555] snd_hda_codec_realtek hdaudioC0D0: Rear Mic=0x18
  922. Oct 27 20:18:09 localhost kernel: [ 5.781556] snd_hda_codec_realtek hdaudioC0D0: Line=0x1a
  923. Oct 27 20:18:09 localhost kernel: [ 5.797025] nuvoton-cir 00:03: found NCT6776F or compatible: chip id: 0xc3 0x33
  924. Oct 27 20:18:09 localhost kernel: [ 5.797708] input: HDA Intel PCH Rear Mic as /devices/pci0000:00/0000:00:1b.0/sound/card0/input4
  925. Oct 27 20:18:09 localhost kernel: [ 5.797779] input: HDA Intel PCH Line as /devices/pci0000:00/0000:00:1b.0/sound/card0/input5
  926. Oct 27 20:18:09 localhost kernel: [ 5.797833] input: HDA Intel PCH Line Out Front as /devices/pci0000:00/0000:00:1b.0/sound/card0/input6
  927. Oct 27 20:18:09 localhost kernel: [ 5.797921] input: HDA Intel PCH Line Out Surround as /devices/pci0000:00/0000:00:1b.0/sound/card0/input7
  928. Oct 27 20:18:09 localhost kernel: [ 5.797983] input: HDA Intel PCH Line Out CLFE as /devices/pci0000:00/0000:00:1b.0/sound/card0/input8
  929. Oct 27 20:18:09 localhost kernel: [ 5.802118] lirc_dev: IR Remote Control driver registered, major 239
  930. Oct 27 20:18:09 localhost kernel: [ 5.803725] IR LIRC bridge handler initialized
  931. Oct 27 20:18:09 localhost kernel: [ 5.836080] Registered IR keymap rc-rc6-mce
  932. Oct 27 20:18:09 localhost kernel: [ 5.844298] IR RC6 protocol handler initialized
  933. Oct 27 20:18:09 localhost kernel: [ 5.844314] usbcore: registered new interface driver usbserial_generic
  934. Oct 27 20:18:09 localhost kernel: [ 5.844325] usbserial: USB Serial support registered for generic
  935. Oct 27 20:18:09 localhost kernel: [ 5.872116] rc rc0: Nuvoton w836x7hg Infrared Remote Transceiver as /devices/pnp0/00:03/rc/rc0
  936. Oct 27 20:18:09 localhost kernel: [ 5.872157] input: Nuvoton w836x7hg Infrared Remote Transceiver as /devices/pnp0/00:03/rc/rc0/input9
  937. Oct 27 20:18:09 localhost kernel: [ 5.874598] lirc lirc0: lirc_dev: driver ir-lirc-codec (nuvoton-cir) registered at minor = 0
  938. Oct 27 20:18:09 localhost kernel: [ 5.874620] nuvoton-cir 00:03: driver has been successfully loaded
  939. Oct 27 20:18:09 localhost kernel: [ 5.882118] usbcore: registered new interface driver ftdi_sio
  940. Oct 27 20:18:09 localhost kernel: [ 5.882129] usbserial: USB Serial support registered for FTDI USB Serial Device
  941. Oct 27 20:18:09 localhost kernel: [ 5.882411] ftdi_sio 1-1.1:1.0: FTDI USB Serial Device converter detected
  942. Oct 27 20:18:09 localhost kernel: [ 5.882443] usb 1-1.1: Detected FT232BM
  943. Oct 27 20:18:09 localhost kernel: [ 5.882668] ftdi_sio ttyUSB0: Unable to read latency timer: -32
  944. Oct 27 20:18:09 localhost kernel: [ 5.883038] usb 1-1.1: FTDI USB Serial Device converter now attached to ttyUSB0
  945. Oct 27 20:18:09 localhost kernel: [ 6.128483] saa7146: register extension 'budget_ci dvb'
  946. Oct 27 20:18:09 localhost kernel: [ 6.128722] saa7146: found saa7146 @ mem 00000000b1b49179 (revision 1, irq 17) (0x13c2,0x1019)
  947. Oct 27 20:18:09 localhost kernel: [ 6.128724] saa7146 (0): dma buffer size 192512
  948. Oct 27 20:18:09 localhost kernel: [ 6.128725] dvbdev: DVB: registering new adapter (TT-Budget S2-3200 PCI)
  949. Oct 27 20:18:09 localhost kernel: [ 6.177088] adapter has MAC addr = 00:d0:5c:68:37:b6
  950. Oct 27 20:18:09 localhost kernel: [ 6.364732] RAPL PMU: API unit is 2^-32 Joules, 3 fixed counters, 163840 ms ovfl timer
  951. Oct 27 20:18:09 localhost kernel: [ 6.364735] RAPL PMU: hw unit of domain pp0-core 2^-16 Joules
  952. Oct 27 20:18:09 localhost kernel: [ 6.364735] RAPL PMU: hw unit of domain package 2^-16 Joules
  953. Oct 27 20:18:09 localhost kernel: [ 6.364736] RAPL PMU: hw unit of domain pp1-gpu 2^-16 Joules
  954. Oct 27 20:18:09 localhost kernel: [ 6.368662] input: HDA NVidia HDMI/DP,pcm=3 as /devices/pci0000:00/0000:00:01.0/0000:01:00.1/sound/card1/input11
  955. Oct 27 20:18:09 localhost kernel: [ 6.368719] input: HDA NVidia HDMI/DP,pcm=7 as /devices/pci0000:00/0000:00:01.0/0000:01:00.1/sound/card1/input12
  956. Oct 27 20:18:09 localhost kernel: [ 6.380474] Registered IR keymap rc-tt-1500
  957. Oct 27 20:18:09 localhost kernel: [ 6.380515] rc rc1: Budget-CI dvb ir receiver saa7146 (0) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:00.0/rc/rc1
  958. Oct 27 20:18:09 localhost kernel: [ 6.380552] input: Budget-CI dvb ir receiver saa7146 (0) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:00.0/rc/rc1/input10
  959. Oct 27 20:18:09 localhost kernel: [ 6.741290] ppdev: user-space parallel port driver
  960. Oct 27 20:18:09 localhost kernel: [ 6.772937] resource sanity check: requesting [mem 0x000c0000-0x000fffff], which spans more than PCI Bus 0000:00 [mem 0x000c0000-0x000dffff window]
  961. Oct 27 20:18:09 localhost kernel: [ 6.773204] caller os_map_kernel_space.part.8+0x10b/0x150 [nvidia] mapping multiple BARs
  962. Oct 27 20:18:09 localhost kernel: [ 7.073699] stb0899_attach: Attaching STB0899
  963. Oct 27 20:18:09 localhost kernel: [ 7.083834] stb6100_attach: Attaching STB6100
  964. Oct 27 20:18:09 localhost kernel: [ 7.091753] LNBx2x attached on addr=8
  965. Oct 27 20:18:09 localhost kernel: [ 7.091757] budget_ci dvb 0000:04:00.0: DVB: registering adapter 0 frontend 0 (STB0899 Multistandard)...
  966. Oct 27 20:18:09 localhost kernel: [ 7.092004] saa7146: found saa7146 @ mem 000000000530131b (revision 1, irq 18) (0x13c2,0x1019)
  967. Oct 27 20:18:09 localhost kernel: [ 7.092006] saa7146 (1): dma buffer size 192512
  968. Oct 27 20:18:09 localhost kernel: [ 7.092007] dvbdev: DVB: registering new adapter (TT-Budget S2-3200 PCI)
  969. Oct 27 20:18:09 localhost kernel: [ 7.102653] intel_rapl: Found RAPL domain package
  970. Oct 27 20:18:09 localhost kernel: [ 7.102654] intel_rapl: Found RAPL domain core
  971. Oct 27 20:18:09 localhost kernel: [ 7.102655] intel_rapl: Found RAPL domain uncore
  972. Oct 27 20:18:09 localhost kernel: [ 7.102660] intel_rapl: RAPL package 0 domain package locked by BIOS
  973. Oct 27 20:18:09 localhost kernel: [ 7.145919] adapter has MAC addr = 00:d0:5c:68:30:6d
  974. Oct 27 20:18:09 localhost kernel: [ 7.160388] Registered IR keymap rc-tt-1500
  975. Oct 27 20:18:09 localhost kernel: [ 7.160424] rc rc2: Budget-CI dvb ir receiver saa7146 (1) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:01.0/rc/rc2
  976. Oct 27 20:18:09 localhost kernel: [ 7.160459] input: Budget-CI dvb ir receiver saa7146 (1) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:01.0/rc/rc2/input13
  977. Oct 27 20:18:09 localhost kernel: [ 7.500685] stb0899_attach: Attaching STB0899
  978. Oct 27 20:18:09 localhost kernel: [ 7.500693] stb6100_attach: Attaching STB6100
  979. Oct 27 20:18:09 localhost kernel: [ 7.500807] LNBx2x attached on addr=8
  980. Oct 27 20:18:09 localhost kernel: [ 7.500812] budget_ci dvb 0000:04:01.0: DVB: registering adapter 1 frontend 0 (STB0899 Multistandard)...
  981. Oct 27 20:18:09 localhost kernel: [ 7.523608] Adding 5242876k swap on /dev/sdb2. Priority:-2 extents:1 across:5242876k SSFS
  982. Oct 27 20:18:09 localhost kernel: [ 8.274179] EXT4-fs (sda4): mounted filesystem with ordered data mode. Opts: (null)
  983. Oct 27 20:18:09 localhost kernel: [ 8.495649] atl1c 0000:05:00.0: atl1c: enp5s0 NIC Link is Up<1000 Mbps Full Duplex>
  984. Oct 27 20:18:09 localhost kernel: [ 8.568083] audit: type=1400 audit(1572203889.767:2): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/sbin/dhclient" pid=831 comm="apparmor_parser"
  985. Oct 27 20:18:09 localhost kernel: [ 8.568088] audit: type=1400 audit(1572203889.767:3): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/lib/NetworkManager/nm-dhcp-client.action" pid=831 comm="apparmor_parser"
  986. Oct 27 20:18:09 localhost kernel: [ 8.568090] audit: type=1400 audit(1572203889.767:4): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/lib/NetworkManager/nm-dhcp-helper" pid=831 comm="apparmor_parser"
  987. Oct 27 20:18:09 localhost kernel: [ 8.568092] audit: type=1400 audit(1572203889.767:5): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/lib/connman/scripts/dhclient-script" pid=831 comm="apparmor_parser"
  988. Oct 27 20:18:09 localhost kernel: [ 8.575102] audit: type=1400 audit(1572203889.771:6): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default" pid=830 comm="apparmor_parser"
  989. Oct 27 20:18:09 localhost kernel: [ 8.575107] audit: type=1400 audit(1572203889.771:7): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default-cgns" pid=830 comm="apparmor_parser"
  990. Oct 27 20:18:09 localhost kernel: [ 8.575108] audit: type=1400 audit(1572203889.771:8): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default-with-mounting" pid=830 comm="apparmor_parser"
  991. Oct 27 20:18:09 localhost kernel: [ 8.575111] audit: type=1400 audit(1572203889.771:9): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default-with-nesting" pid=830 comm="apparmor_parser"
  992. Oct 27 20:18:09 localhost kernel: [ 8.576231] audit: type=1400 audit(1572203889.775:10): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/bin/lxc-start" pid=833 comm="apparmor_parser"
  993. Oct 27 20:18:09 localhost kernel: [ 8.578443] audit: type=1400 audit(1572203889.775:11): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/bin/man" pid=834 comm="apparmor_parser"
  994. Oct 27 20:18:09 localhost systemd[1]: Started System Logging Service.
  995. Oct 27 20:18:09 localhost rsyslogd: imuxsock: Acquired UNIX socket '/run/systemd/journal/syslog' (fd 3) from systemd. [v8.32.0]
  996. Oct 27 20:18:09 localhost rsyslogd: rsyslogd's groupid changed to 106
  997. Oct 27 20:18:09 localhost rsyslogd: rsyslogd's userid changed to 102
  998. Oct 27 20:18:09 localhost rsyslogd: [origin software="rsyslogd" swVersion="8.32.0" x-pid="871" x-info="http://www.rsyslog.com"] start
  999. Oct 27 20:18:09 localhost avahi-daemon[860]: Successfully dropped root privileges.
  1000. Oct 27 20:18:09 localhost avahi-daemon[860]: avahi-daemon 0.7 starting up.
  1001. Oct 27 20:18:09 localhost cron[869]: (CRON) INFO (Running @reboot jobs)
  1002. Oct 27 20:18:09 localhost systemd[1]: Started Save/Restore Sound Card State.
  1003. Oct 27 20:18:09 localhost systemd[1]: Started Avahi mDNS/DNS-SD Stack.
  1004. Oct 27 20:18:09 localhost avahi-daemon[860]: Successfully called chroot().
  1005. Oct 27 20:18:09 localhost avahi-daemon[860]: Successfully dropped remaining capabilities.
  1006. Oct 27 20:18:09 localhost sensors[900]: coretemp-isa-0000
  1007. Oct 27 20:18:09 localhost sensors[900]: Adapter: ISA adapter
  1008. Oct 27 20:18:09 localhost sensors[900]: Package id 0: +38.0°C (high = +82.0°C, crit = +102.0°C)
  1009. Oct 27 20:18:09 localhost sensors[900]: Core 0: +34.0°C (high = +82.0°C, crit = +102.0°C)
  1010. Oct 27 20:18:09 localhost sensors[900]: Core 1: +38.0°C (high = +82.0°C, crit = +102.0°C)
  1011. Oct 27 20:18:09 localhost systemd[1]: Started Initialize hardware monitoring sensors.
  1012. Oct 27 20:18:09 localhost kernel: [ 8.784920] new mount options do not match the existing superblock, will be ignored
  1013. Oct 27 20:18:09 localhost grub-common[870]: * Recording successful boot for GRUB
  1014. Oct 27 20:18:10 localhost lxcfs[877]: mount namespace: 5
  1015. Oct 27 20:18:10 localhost lxcfs[877]: hierarchies:
  1016. Oct 27 20:18:10 localhost lxcfs[877]: 0: fd: 6: pids
  1017. Oct 27 20:18:10 localhost lxcfs[877]: 1: fd: 7: hugetlb
  1018. Oct 27 20:18:10 localhost lxcfs[877]: 2: fd: 8: rdma
  1019. Oct 27 20:18:10 localhost lxcfs[877]: 3: fd: 9: cpu,cpuacct
  1020. Oct 27 20:18:10 localhost lxcfs[877]: 4: fd: 10: memory
  1021. Oct 27 20:18:10 localhost lxcfs[877]: 5: fd: 11: net_cls,net_prio
  1022. Oct 27 20:18:10 localhost lxcfs[877]: 6: fd: 12: cpuset
  1023. Oct 27 20:18:10 localhost lxcfs[877]: 7: fd: 13: freezer
  1024. Oct 27 20:18:10 localhost lxcfs[877]: 8: fd: 14: devices
  1025. Oct 27 20:18:10 localhost lxcfs[877]: 9: fd: 15: blkio
  1026. Oct 27 20:18:10 localhost lxcfs[877]: 10: fd: 16: perf_event
  1027. Oct 27 20:18:10 localhost lxcfs[877]: 11: fd: 17: name=systemd
  1028. Oct 27 20:18:10 localhost lxcfs[877]: 12: fd: 18: unified
  1029. Oct 27 20:18:10 localhost systemd[1]: Started WPA supplicant.
  1030. Oct 27 20:18:10 localhost wpa_supplicant[884]: Successfully initialized wpa_supplicant
  1031. Oct 27 20:18:10 localhost systemd[1]: Reached target Network.
  1032. Oct 27 20:18:10 localhost systemd[1]: Starting MariaDB 10.1.41 database server...
  1033. Oct 27 20:18:10 localhost systemd[1]: Starting OScam...
  1034. Oct 27 20:18:10 localhost systemd[1]: Starting NFS Mount Daemon...
  1035. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-audio.service.
  1036. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-backups.service.
  1037. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-files.service.
  1038. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-pictures.service.
  1039. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-recordings.service.
  1040. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-video.service.
  1041. Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface enp5s0.IPv6 with address fe80::225:22ff:fee6:40ba.
  1042. Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface enp5s0.IPv6 for mDNS.
  1043. Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface enp5s0.IPv4 with address 192.168.192.150.
  1044. Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface enp5s0.IPv4 for mDNS.
  1045. Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface lo.IPv6 with address ::1.
  1046. Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface lo.IPv6 for mDNS.
  1047. Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface lo.IPv4 with address 127.0.0.1.
  1048. Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface lo.IPv4 for mDNS.
  1049. Oct 27 20:18:10 localhost avahi-daemon[860]: Network interface enumeration completed.
  1050. Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for fe80::225:22ff:fee6:40ba on enp5s0.*.
  1051. Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for 192.168.192.150 on enp5s0.IPv4.
  1052. Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for ::1 on lo.*.
  1053. Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for 127.0.0.1 on lo.IPv4.
  1054. Oct 27 20:18:10 localhost systemd[1]: Started Login Service.
  1055. Oct 27 20:18:10 localhost systemd[1]: Started Unattended Upgrades Shutdown.
  1056. Oct 27 20:18:10 localhost systemd[1]: Started LXD - container startup/shutdown.
  1057. Oct 27 20:18:10 localhost udisksd[879]: udisks daemon version 2.7.6 starting
  1058. Oct 27 20:18:10 localhost dbus-daemon[883]: [system] Activating via systemd: service name='org.freedesktop.PolicyKit1' unit='polkit.service' requested by ':1.6' (uid=0 pid=881 comm="/usr/lib/accountsservice/accounts-daemon " label="unconfined")
  1059. Oct 27 20:18:10 localhost systemd[1]: Starting Authorization Manager...
  1060. Oct 27 20:18:10 localhost systemd[1]: oscam.service: Can't open PID file /var/run/oscam.pid (yet?) after start: No such file or directory
  1061. Oct 27 20:18:10 localhost grub-common[870]: ...done.
  1062. Oct 27 20:18:10 localhost systemd[1]: Started LSB: Record successful boot for GRUB.
  1063. Oct 27 20:18:10 localhost systemd[1]: oscam.service: Supervising process 923 which is not our child. We'll most likely not notice when it exits.
  1064. Oct 27 20:18:10 localhost systemd[1]: Started OScam.
  1065. Oct 27 20:18:10 localhost snapd[874]: AppArmor status: apparmor is enabled and all features are available
  1066. Oct 27 20:18:10 localhost systemd[1]: Started lircd(8) initialization helper tool.
  1067. Oct 27 20:18:10 localhost udisksd[879]: failed to load module crypto: libbd_crypto.so.2: cannot open shared object file: No such file or directory
  1068. Oct 27 20:18:10 localhost udisksd[879]: failed to load module mdraid: libbd_mdraid.so.2: cannot open shared object file: No such file or directory
  1069. Oct 27 20:18:10 localhost udisksd[879]: Failed to load the 'mdraid' libblockdev plugin
  1070. Oct 27 20:18:10 localhost udisksd[879]: Failed to load the 'crypto' libblockdev plugin
  1071. Oct 27 20:18:10 localhost kernel: [ 9.043918] ftdi_sio ttyUSB0: FTDI USB Serial Device converter now disconnected from ttyUSB0
  1072. Oct 27 20:18:10 localhost kernel: [ 9.043935] ftdi_sio 1-1.1:1.0: device disconnected
  1073. Oct 27 20:18:10 localhost polkitd[920]: started daemon version 0.105 using authority implementation `local' version `0.105'
  1074. Oct 27 20:18:10 localhost dbus-daemon[883]: [system] Successfully activated service 'org.freedesktop.PolicyKit1'
  1075. Oct 27 20:18:10 localhost systemd[1]: Started Authorization Manager.
  1076. Oct 27 20:18:10 localhost accounts-daemon[881]: started daemon version 0.6.45
  1077. Oct 27 20:18:10 localhost systemd[1]: Started Accounts Service.
  1078. Oct 27 20:18:10 localhost rpc.mountd[953]: Version 1.3.3 starting
  1079. Oct 27 20:18:10 localhost systemd[1]: Started NFS Mount Daemon.
  1080. Oct 27 20:18:10 localhost systemd[1]: Starting NFS server and services...
  1081. Oct 27 20:18:10 localhost snapd[874]: daemon.go:338: started snapd/2.40+18.04 (series 16; classic) ubuntu/18.04 (amd64) linux/4.15.0-66-generic.
  1082. Oct 27 20:18:10 localhost nfsdcltrack[958]: Failed to init database: -13
  1083. Oct 27 20:18:10 localhost kernel: [ 9.148299] NFSD: Using /var/lib/nfs/v4recovery as the NFSv4 state recovery directory
  1084. Oct 27 20:18:10 localhost kernel: [ 9.148554] NFSD: starting 90-second grace period (net f0000099)
  1085. Oct 27 20:18:10 localhost networkd-dispatcher[867]: No valid path found for iwconfig
  1086. Oct 27 20:18:10 localhost systemd[1]: Started NFS server and services.
  1087. Oct 27 20:18:10 localhost systemd[1]: Started Snappy daemon.
  1088. Oct 27 20:18:10 localhost systemd[1]: Starting Wait until snapd is fully seeded...
  1089. Oct 27 20:18:10 localhost systemd[1]: Started Dispatcher daemon for systemd-networkd.
  1090. Oct 27 20:18:10 localhost systemd[1]: Started Wait until snapd is fully seeded.
  1091. Oct 27 20:18:10 localhost systemd[1]: Started Disk Manager.
  1092. Oct 27 20:18:10 localhost udisksd[879]: Acquired the name org.freedesktop.UDisks2 on the system message bus
  1093. Oct 27 20:18:10 localhost udisksd[879]: Cleaning up mount point /media/vdr/3451-ADE2 (device 8:35 is not mounted)
  1094. Oct 27 20:18:10 localhost udisksd[879]: Cleaning up mount point /media/vdr/327B-9667 (device 8:33 is not mounted)
  1095. Oct 27 20:18:10 localhost mysqld[1076]: 2019-10-27 20:18:10 140054344481920 [Note] /usr/sbin/mysqld (mysqld 10.1.41-MariaDB-0ubuntu0.18.04.1) starting as process 1076 ...
  1096. Oct 27 20:18:10 localhost avahi-daemon[860]: Server startup complete. Host name is myVDR.local. Local service cookie is 1435830800.
  1097. Oct 27 20:18:11 localhost systemd-networkd[765]: enp5s0: Gained IPv6LL
  1098. Oct 27 20:18:11 localhost systemd-networkd[765]: enp5s0: Configured
  1099. Oct 27 20:18:11 localhost systemd-networkd-wait-online[791]: ignoring: lo
  1100. Oct 27 20:18:11 localhost systemd-networkd-wait-online[791]: managing: enp5s0
  1101. Oct 27 20:18:11 localhost systemd-timesyncd[762]: Network configuration changed, trying to establish connection.
  1102. Oct 27 20:18:11 localhost systemd[1]: Started Wait for Network to be Configured.
  1103. Oct 27 20:18:11 localhost systemd[1]: Reached target Network is Online.
  1104. Oct 27 20:18:11 localhost systemd[1]: Starting Postfix Mail Transport Agent (instance -)...
  1105. Oct 27 20:18:11 localhost systemd[1]: Starting Availability of block devices...
  1106. Oct 27 20:18:11 localhost systemd[1]: Reached target Remote File Systems (Pre).
  1107. Oct 27 20:18:11 localhost systemd[1]: Reached target Remote File Systems.
  1108. Oct 27 20:18:11 localhost systemd[1]: Starting LSB: automatic crash report generation...
  1109. Oct 27 20:18:11 localhost systemd[1]: Starting LSB: Adaptive readahead daemon...
  1110. Oct 27 20:18:11 localhost systemd[1]: Starting Permit User Sessions...
  1111. Oct 27 20:18:11 localhost systemd[1]: Starting Samba NMB Daemon...
  1112. Oct 27 20:18:11 localhost systemd[1]: Starting Automounts filesystems on demand...
  1113. Oct 27 20:18:11 localhost systemd[1]: Starting OpenBSD Secure Shell server...
  1114. Oct 27 20:18:11 localhost systemd[1]: Started Availability of block devices.
  1115. Oct 27 20:18:11 localhost systemd[1]: Started Permit User Sessions.
  1116. Oct 27 20:18:11 localhost systemd[1]: Starting Hold until boot process finishes up...
  1117. Oct 27 20:18:11 localhost systemd[1]: Starting Terminate Plymouth Boot Screen...
  1118. Oct 27 20:18:11 localhost systemd[1]: Received SIGRTMIN+21 from PID 280 (plymouthd).
  1119. Oct 27 20:18:11 localhost systemd[1]: Started Terminate Plymouth Boot Screen.
  1120. Oct 27 20:18:11 localhost systemd[1]: Started Hold until boot process finishes up.
  1121. Oct 27 20:18:11 localhost systemd[1]: Starting Set console scheme...
  1122. Oct 27 20:18:11 localhost systemd[1]: Starting X on vt7...
  1123. Oct 27 20:18:11 localhost systemd[1]: Started OpenBSD Secure Shell server.
  1124. Oct 27 20:18:11 localhost systemd[1]: Started Set console scheme.
  1125. Oct 27 20:18:11 localhost systemd[1]: Created slice system-getty.slice.
  1126. Oct 27 20:18:11 localhost systemd[1]: Started Getty on tty1.
  1127. Oct 27 20:18:11 localhost systemd[1]: Reached target Login Prompts.
  1128. Oct 27 20:18:11 localhost apport[1102]: * Starting automatic crash report generation: apport
  1129. Oct 27 20:18:11 localhost x-daemon[1147]: X.Org X Server 1.19.6
  1130. Oct 27 20:18:11 localhost x-daemon[1147]: Release Date: 2017-12-20
  1131. Oct 27 20:18:11 localhost x-daemon[1147]: X Protocol Version 11, Revision 0
  1132. Oct 27 20:18:11 localhost x-daemon[1147]: Build Operating System: Linux 4.4.0-148-generic x86_64 Ubuntu
  1133. Oct 27 20:18:11 localhost x-daemon[1147]: Current Operating System: Linux myVDR 4.15.0-66-generic #75-Ubuntu SMP Tue Oct 1 05:24:09 UTC 2019 x86_64
  1134. Oct 27 20:18:11 localhost x-daemon[1147]: Kernel command line: BOOT_IMAGE=/boot/vmlinuz-4.15.0-66-generic root=UUID=3a2488fb-8ae8-4722-b647-c95071d7e0af ro quiet splash vt.handoff=1
  1135. Oct 27 20:18:11 localhost x-daemon[1147]: Build Date: 03 June 2019 08:10:35AM
  1136. Oct 27 20:18:11 localhost x-daemon[1147]: xorg-server 2:1.19.6-1ubuntu4.3 (For technical support please see http://www.ubuntu.com/support)
  1137. Oct 27 20:18:11 localhost x-daemon[1147]: Current version of pixman: 0.34.0
  1138. Oct 27 20:18:11 localhost x-daemon[1147]: #011Before reporting problems, check http://wiki.x.org
  1139. Oct 27 20:18:11 localhost x-daemon[1147]: #011to make sure that you have the latest version.
  1140. Oct 27 20:18:11 localhost x-daemon[1147]: Markers: (--) probed, (**) from config file, (==) default setting,
  1141. Oct 27 20:18:11 localhost x-daemon[1147]: #011(++) from command line, (!!) notice, (II) informational,
  1142. Oct 27 20:18:11 localhost x-daemon[1147]: #011(WW) warning, (EE) error, (NI) not implemented, (??) unknown.
  1143. Oct 27 20:18:11 localhost x-daemon[1147]: (==) Log file: "/var/log/Xorg.0.log", Time: Sun Oct 27 20:18:11 2019
  1144. Oct 27 20:18:11 localhost x-daemon[1147]: (==) Using config file: "/etc/X11/xorg.conf"
  1145. Oct 27 20:18:11 localhost x-daemon[1147]: (==) Using config directory: "/etc/X11/xorg.conf.d"
  1146. Oct 27 20:18:11 localhost x-daemon[1147]: (==) Using system config directory "/usr/share/X11/xorg.conf.d"
  1147. Oct 27 20:18:11 localhost preload[1105]: * Starting Adaptive readahead daemon preload
  1148. Oct 27 20:18:11 localhost systemd[1]: Started Automounts filesystems on demand.
  1149. Oct 27 20:18:11 localhost systemd[1]: Started Avahi linker.
  1150. Oct 27 20:18:11 localhost systemd[1]: Started prevent-umount-on-pause.service.
  1151. Oct 27 20:18:11 localhost systemd[1]: Started vdr-update-monitor.
  1152. Oct 27 20:18:11 localhost apport[1102]: ...done.
  1153. Oct 27 20:18:11 localhost systemd[1]: Started LSB: automatic crash report generation.
  1154. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Video on myVDR" (/services/yavdr-video.service) successfully established.
  1155. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Recordings on myVDR" (/services/yavdr-recordings.service) successfully established.
  1156. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Pictures on myVDR" (/services/yavdr-pictures.service) successfully established.
  1157. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Files on myVDR" (/services/yavdr-files.service) successfully established.
  1158. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Backups on myVDR" (/services/yavdr-backups.service) successfully established.
  1159. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Audio on myVDR" (/services/yavdr-audio.service) successfully established.
  1160. Oct 27 20:18:11 localhost systemd[1]: Started Samba NMB Daemon.
  1161. Oct 27 20:18:11 localhost systemd[1]: Starting Samba SMB Daemon...
  1162. Oct 27 20:18:11 localhost preload[1105]: ...done.
  1163. Oct 27 20:18:11 localhost systemd[1]: Started LSB: Adaptive readahead daemon.
  1164. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,275 INFO Started avahi-linker
  1165. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,307 INFO skip local service 'Video on myVDR' type '_nfs._tcp' domain 'local'
  1166. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,307 INFO skip local service 'Recordings on myVDR' type '_nfs._tcp' domain 'local'
  1167. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Pictures on myVDR' type '_nfs._tcp' domain 'local'
  1168. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Files on myVDR' type '_nfs._tcp' domain 'local'
  1169. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Backups on myVDR' type '_nfs._tcp' domain 'local'
  1170. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Audio on myVDR' type '_nfs._tcp' domain 'local'
  1171. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Video on myVDR' type '_nfs._tcp' domain 'local'
  1172. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Recordings on myVDR' type '_nfs._tcp' domain 'local'
  1173. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Pictures on myVDR' type '_nfs._tcp' domain 'local'
  1174. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Files on myVDR' type '_nfs._tcp' domain 'local'
  1175. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Backups on myVDR' type '_nfs._tcp' domain 'local'
  1176. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Audio on myVDR' type '_nfs._tcp' domain 'local'
  1177. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Video on myVDR' type '_nfs._tcp' domain 'local'
  1178. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Recordings on myVDR' type '_nfs._tcp' domain 'local'
  1179. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Pictures on myVDR' type '_nfs._tcp' domain 'local'
  1180. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Files on myVDR' type '_nfs._tcp' domain 'local'
  1181. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Backups on myVDR' type '_nfs._tcp' domain 'local'
  1182. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,311 INFO skip local service 'Audio on myVDR' type '_nfs._tcp' domain 'local'
  1183. Oct 27 20:18:12 localhost kernel: [ 11.128854] resource sanity check: requesting [mem 0x000c0000-0x000fffff], which spans more than PCI Bus 0000:00 [mem 0x000c0000-0x000dffff window]
  1184. Oct 27 20:18:12 localhost kernel: [ 11.129108] caller os_map_kernel_space.part.8+0x10b/0x150 [nvidia] mapping multiple BARs
  1185. Oct 27 20:18:12 localhost systemd[1]: Started Samba SMB Daemon.
  1186. Oct 27 20:18:12 localhost systemd[1]: Starting NVIDIA Persistence Daemon...
  1187. Oct 27 20:18:12 localhost systemd[1]: Started NVIDIA Persistence Daemon.
  1188. Oct 27 20:18:12 localhost nvidia-persistenced: Verbose syslog connection opened
  1189. Oct 27 20:18:12 localhost nvidia-persistenced: Now running with user ID 111 and group ID 116
  1190. Oct 27 20:18:12 localhost nvidia-persistenced: Started (1549)
  1191. Oct 27 20:18:12 localhost nvidia-persistenced: device 0000:01:00.0 - registered
  1192. Oct 27 20:18:12 localhost nvidia-persistenced: Local RPC service initialized
  1193. Oct 27 20:18:12 localhost systemd[1]: Started ACPI event daemon.
  1194. Oct 27 20:18:12 localhost acpid: starting up with netlink and the input layer
  1195. Oct 27 20:18:12 localhost acpid: 0 rules loaded
  1196. Oct 27 20:18:12 localhost acpid: waiting for events: event logging is off
  1197. Oct 27 20:18:12 localhost acpid: client connected from 1149[0:0]
  1198. Oct 27 20:18:12 localhost acpid: 1 client rule loaded
  1199. Oct 27 20:18:13 localhost systemd[1]: Started X on vt7.
  1200. Oct 27 20:18:13 localhost systemd[1]: Starting Video Disk Recorder...
  1201. Oct 27 20:18:13 localhost systemd[1]: Started Direct X login for user vdr.
  1202. Oct 27 20:18:13 localhost systemd[1]: Starting Start a X session and a systemd user session for the vdr user...
  1203. Oct 27 20:18:13 localhost systemd[1]: Started Start a X session and a systemd user session for the vdr user.
  1204. Oct 27 20:18:13 localhost systemd[1]: Created slice User Slice of vdr.
  1205. Oct 27 20:18:13 localhost systemd[1]: Starting User Manager for UID 666...
  1206. Oct 27 20:18:13 localhost systemd[1]: Started Session 1 of user vdr.
  1207. Oct 27 20:18:13 localhost vdr: [1799] VDR version 2.4.0 started
  1208. Oct 27 20:18:13 localhost vdr: [1799] switched to user 'vdr'
  1209. Oct 27 20:18:13 localhost vdr: [1799] codeset is 'UTF-8' - known
  1210. Oct 27 20:18:13 localhost systemd[1773]: Starting D-Bus User Message Bus Socket.
  1211. Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent (ssh-agent emulation).
  1212. Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent and passphrase cache (access for web browsers).
  1213. Oct 27 20:18:13 localhost systemd[1773]: Listening on Sound System.
  1214. Oct 27 20:18:13 localhost systemd[1773]: Reached target Timers.
  1215. Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent and passphrase cache.
  1216. Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG network certificate management daemon.
  1217. Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent and passphrase cache (restricted).
  1218. Oct 27 20:18:13 localhost systemd[1773]: Reached target Paths.
  1219. Oct 27 20:18:13 localhost systemd[1773]: Listening on D-Bus User Message Bus Socket.
  1220. Oct 27 20:18:13 localhost systemd[1773]: Reached target Sockets.
  1221. Oct 27 20:18:13 localhost systemd[1773]: Reached target Basic System.
  1222. Oct 27 20:18:13 localhost systemd[1]: Started User Manager for UID 666.
  1223. Oct 27 20:18:13 localhost systemd[1773]: Started exit window manager gracefully.
  1224. Oct 27 20:18:13 localhost systemd[1773]: Starting Start tmux in detached session...
  1225. Oct 27 20:18:13 localhost systemd[1773]: Starting Sound Service...
  1226. Oct 27 20:18:13 localhost systemd[1773]: Started Start tmux in detached session.
  1227. Oct 27 20:18:13 localhost systemd[1773]: Started D-Bus User Message Bus.
  1228. Oct 27 20:18:13 localhost dbus-daemon[1864]: [session uid=666 pid=1864] AppArmor D-Bus mediation is enabled
  1229. Oct 27 20:18:13 localhost postfix/postfix-script[1872]: starting the Postfix mail system
  1230. Oct 27 20:18:13 localhost vdr: [1799] found 28 locales in /usr/share/locale
  1231. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-dvbapi.so.2.4.0
  1232. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-conflictcheckonly.so.2.4.0
  1233. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-dbus2vdr.so.2.4.0
  1234. Oct 27 20:18:13 localhost vdr: [1799] dbus2vdr: use shutdown-hooks in /usr/share/vdr/shutdown-hooks
  1235. Oct 27 20:18:13 localhost vdr: [1799] dbus2vdr: use shutdown-hooks-wrapper /usr/share/vdr-plugin-dbus2vdr/shutdown-wrapper
  1236. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-desktop.so.2.4.0
  1237. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-devstatus.so.2.4.0
  1238. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-epg2vdr.so.2.4.0
  1239. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-epgsearch.so.2.4.0
  1240. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-epgsearchonly.so.2.4.0
  1241. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-live.so.2.4.0
  1242. Oct 27 20:18:13 localhost vdr: [1799] [live] INFO: validating server ip '0.0.0.0'
  1243. Oct 27 20:18:13 localhost vdr[1799]: INFO: validating live server ip '0.0.0.0'
  1244. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-markad.so.2.4.0
  1245. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-menuorg.so.2.4.0
  1246. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-osd2web.so.2.4.0
  1247. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-osdteletext.so.2.4.0
  1248. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-pulsecontrol.so.2.4.0
  1249. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-quickepgsearch.so.2.4.0
  1250. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-scraper2vdr.so.2.4.0
  1251. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-skindesigner.so.2.4.0
  1252. Oct 27 20:18:13 localhost postfix/master[1876]: daemon started -- version 3.3.0, configuration /etc/postfix
  1253. Oct 27 20:18:13 localhost systemd[1]: Started Postfix Mail Transport Agent (instance -).
  1254. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-softhddevice.so.2.4.0
  1255. Oct 27 20:18:13 localhost systemd[1]: Starting Postfix Mail Transport Agent...
  1256. Oct 27 20:18:13 localhost systemd[1]: Started Postfix Mail Transport Agent.
  1257. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-streamdev-server.so.2.4.0
  1258. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-wirbelscan.so.2.4.0
  1259. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/setup.conf
  1260. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/sources.conf
  1261. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/diseqc.conf
  1262. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/scr.conf
  1263. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/channels.conf
  1264. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/timers.conf
  1265. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/commands.conf
  1266. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/reccmds.conf
  1267. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/svdrphosts.conf
  1268. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/remote.conf
  1269. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/keymacros.conf
  1270. Oct 27 20:18:13 localhost vdr: [1799] ERROR: unknown plugin 'xineliboutput'
  1271. Oct 27 20:18:13 localhost vdr: [1907] video directory scanner thread started (pid=1799, tid=1907, prio=low)
  1272. Oct 27 20:18:13 localhost vdr: [1908] epg data reader thread started (pid=1799, tid=1908, prio=high)
  1273. Oct 27 20:18:13 localhost vdr: [1908] reading EPG data from /var/cache/vdr/epg.data
  1274. Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'A - ATSC'
  1275. Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'C - DVB-C'
  1276. Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'S - DVB-S'
  1277. Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'T - DVB-T'
  1278. Oct 27 20:18:13 localhost vdr: [1799] probing /dev/dvb/adapter0/frontend0
  1279. Oct 27 20:18:13 localhost vdr: [1799] creating cDvbDevice
  1280. Oct 27 20:18:13 localhost vdr: [1799] new device number 1
  1281. Oct 27 20:18:13 localhost bash[1749]: Openbox-Message: Keine gültige Menü-Datei "/var/lib/openbox/debian-menu.xml" vorhanden
  1282. Oct 27 20:18:13 localhost vdr: [1799] DVB API version is 0x050A (VDR was built with 0x050A)
  1283. Oct 27 20:18:13 localhost vdr: [1799] frontend 0/0 provides DVB-S,DVB-S2,DSS with QPSK ("STB0899 Multistandard")
  1284. Oct 27 20:18:13 localhost vdr: [1799] cTimeMs: using monotonic clock (resolution is 1 ns)
  1285. Oct 27 20:18:13 localhost vdr: [1799] probing /dev/dvb/adapter1/frontend0
  1286. Oct 27 20:18:13 localhost vdr: [1799] creating cDvbDevice
  1287. Oct 27 20:18:13 localhost vdr: [1799] new device number 2
  1288. Oct 27 20:18:13 localhost vdr: [1920] frontend 0/0 tuner thread started (pid=1799, tid=1920, prio=high)
  1289. Oct 27 20:18:13 localhost vdr: [1921] device 1 section handler thread started (pid=1799, tid=1921, prio=low)
  1290. Oct 27 20:18:14 localhost systemd[1773]: Reloading.
  1291. Oct 27 20:18:14 localhost vdr: [1799] frontend 1/0 provides DVB-S,DVB-S2,DSS with QPSK ("STB0899 Multistandard")
  1292. Oct 27 20:18:14 localhost vdr: [1799] found 2 DVB devices
  1293. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: dvbapi (2.2.5): SoftCAM für OSCam
  1294. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: conflictcheckonly (0.0.1): Direkter Zugriff auf epgsearch's Konflikt-Prüfungs-Menü
  1295. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: dbus2vdr (31): Steuerung des VDR über D-Bus
  1296. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: desktop (0.0.3): desktop apps menu
  1297. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: devstatus (0.4.1): DVB-Gerätestatus
  1298. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: epg2vdr (1.1.98-GIT): epg2vdr plugin
  1299. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: epgsearch (2.4.0): Suche im EPG nach Wiederholungen und anderem
  1300. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: epgsearchonly (0.0.1): Direkter Zugriff auf epgsearch's Suchenmenu
  1301. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: live (2.3.1): Live Interactive VDR Environment
  1302. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: markad (0.1.6): Markiere Werbung
  1303. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: menuorg (0.5.2): Reorganisiert das Haupmenü
  1304. Oct 27 20:18:14 localhost vdr: [1799] loading menuorg config file from /var/lib/vdr/plugins/menuorg.xml
  1305. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: osd2web (0.2.48-GIT): osd2web plugin
  1306. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: osdteletext (0.9.7): Zeigt den Videotext auf dem OSD an
  1307. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: pulsecontrol (0.2.1): Pulseaudio über das OSD steuern
  1308. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: quickepgsearch (0.0.1): Schnelle Suche nach Sendungen
  1309. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: scraper2vdr (1.0.11-GIT): 'scraper2vdr' plugin
  1310. Oct 27 20:18:14 localhost vdr: scraper2vdr: using image directory /var/cache/vdr/epgimages/
  1311. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: skindesigner (1.2.8): Skin Designer
  1312. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: softhddevice (0.6.1rc1): Ein Software und GPU emulieres HD-Gerät
  1313. Oct 27 20:18:14 localhost vdr: [1799] new device number 3
  1314. Oct 27 20:18:14 localhost vdr: [1932] device 2 section handler thread started (pid=1799, tid=1932, prio=low)
  1315. Oct 27 20:18:14 localhost vdr: [1931] frontend 1/0 tuner thread started (pid=1799, tid=1931, prio=high)
  1316. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: streamdev-server (0.6.1-git): VDR Streaming Server
  1317. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: wirbelscan (2017.06.04): DVB channel scan for VDR
  1318. Oct 27 20:18:14 localhost vdr: [1799] setting primary device to 3
  1319. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]MakePrimaryDevice: 1
  1320. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]stopping OpenGL Worker Thread
  1321. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]OpenGL Worker Thread stopped
  1322. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]SetVideoFormat: 1
  1323. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1324. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1325. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]SetVolumeDevice: 55
  1326. Oct 27 20:18:14 localhost vdr: [1799] assuming manual start of VDR
  1327. Oct 27 20:18:14 localhost vdr: [1799] skin "mynew_estuary" not available - using "lcars" instead
  1328. Oct 27 20:18:14 localhost vdr: [1799] loading /var/lib/vdr/themes/lcars-default.theme
  1329. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: dvbapi
  1330. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: plugin version 2.2.5 initializing (VDR 2.4.0)
  1331. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: decryption library: libdvbcsa
  1332. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: Creating sCCIAdapter
  1333. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: Creating SCCAMSlot for device 1
  1334. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: Creating SCCAMSlot for device 2
  1335. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: plugin started
  1336. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: conflictcheckonly
  1337. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: dbus2vdr
  1338. Oct 27 20:18:14 localhost vdr: [1934] Socket Handler thread started (pid=1799, tid=1934, prio=high)
  1339. Oct 27 20:18:14 localhost vdr: [1937] dbus2vdr: mainloop started
  1340. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: desktop
  1341. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: devstatus
  1342. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: epg2vdr
  1343. Oct 27 20:18:14 localhost vdr: epg2vdr: Info: Calling mysql_library_init()
  1344. Oct 27 20:18:14 localhost vdr: epg2vdr: Set locale to 'de_AT.UTF-8'
  1345. Oct 27 20:18:14 localhost vdr: epg2vdr: detected UTF-8
  1346. Oct 27 20:18:14 localhost vdr: epg2vdr: Dictionary '/var/lib/vdr/plugins/epg2vdr//epg.dat' loaded
  1347. Oct 27 20:18:14 localhost vdr: [1936] SC-CI adapter thread started (pid=1799, tid=1936, prio=high)
  1348. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: epgsearch
  1349. Oct 27 20:18:14 localhost vdr: [1799] loading /var/lib/vdr/plugins/epgsearch/epgsearchcats.conf
  1350. Oct 27 20:18:14 localhost vdr: [1799] loading /var/lib/vdr/plugins/epgsearch/epgsearchmenu.conf
  1351. Oct 27 20:18:14 localhost vdr: [1940] epg2vdr-update thread started (pid=1799, tid=1940, prio=high)
  1352. Oct 27 20:18:14 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
  1353. Oct 27 20:18:14 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
  1354. Oct 27 20:18:14 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open vdrs)
  1355. Oct 27 20:18:14 localhost vdr: [1937] dbus2vdr: System: connected with unique name :1.30
  1356. Oct 27 20:18:14 localhost vdr: [1937] dbus2vdr: thread-pool for handling signal-emits started
  1357. Oct 27 20:18:14 localhost avahi-linker[1162]: 2019-10-27 20:18:14,142 INFO VDR started
  1358. Oct 27 20:18:14 localhost systemd[1773]: Reloading.
  1359. Oct 27 20:18:14 localhost systemd[1773]: message repeated 4 times: [ Reloading.]
  1360. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 0.0: doReply changed, reset triggered
  1361. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 0.0: now using CAIDs version 1
  1362. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 0.0: status 'present'
  1363. Oct 27 20:18:14 localhost vdr: [1936] CAM 1: module present
  1364. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 1.1: doReply changed, reset triggered
  1365. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 1.1: now using CAIDs version 1
  1366. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 1.1: status 'present'
  1367. Oct 27 20:18:14 localhost vdr: [1936] CAM 2: module present
  1368. Oct 27 20:18:14 localhost systemd[1773]: Reloading.
  1369. Oct 27 20:18:14 localhost systemd[1773]: message repeated 2 times: [ Reloading.]
  1370. Oct 27 20:18:14 localhost set-cpufreq[873]: Setting powersave scheduler for all CPUs
  1371. Oct 27 20:18:14 localhost systemd[1773]: Started Sound Service.
  1372. Oct 27 20:18:14 localhost systemd[1773]: Reached target Default.
  1373. Oct 27 20:18:14 localhost systemd[1773]: Startup finished in 1.830s.
  1374. Oct 27 20:18:14 localhost vdr: [1908] epg data reader thread ended (pid=1799, tid=1908)
  1375. Oct 27 20:18:14 localhost systemd[1773]: Started LIRC command handler.
  1376. Oct 27 20:18:14 localhost systemd[1773]: Starting Detect second DISPLAY using xrandr...
  1377. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: epgsearchonly
  1378. Oct 27 20:18:14 localhost vdr: [2046] EPGSearch: conflictcheck thread started (pid=1799, tid=2046, prio=high)
  1379. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: live
  1380. Oct 27 20:18:14 localhost vdr: [1799] LIVE: initial file cache has 82 entries and needs 376715 bytes of data!
  1381. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: markad
  1382. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: menuorg
  1383. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: osd2web
  1384. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: osdteletext
  1385. Oct 27 20:18:14 localhost vdr: osd2web: osd2web plugin thread started (pid=1799)
  1386. Oct 27 20:18:14 localhost vdr: [1799] OSD-Teletext: Error statfs'ing root directory "/run/shm/vtx": Datei oder Verzeichnis nicht gefunden, cache size uncontrolled
  1387. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: pulsecontrol
  1388. Oct 27 20:18:14 localhost vdr: [2047] [live] INFO: attempt to listen on ip = '0.0.0.0'
  1389. Oct 27 20:18:14 localhost vdr[1799]: vdr: error while reading '/var/lib/vdr/plugins/pulsecontrol/startup.script'
  1390. Oct 27 20:18:14 localhost vdr: [1799] pulsecontrol: error on reading script /var/lib/vdr/plugins/pulsecontrol/startup.script
  1391. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: quickepgsearch
  1392. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: scraper2vdr
  1393. Oct 27 20:18:14 localhost vdr: epg2vdr: Info: Skipping calling mysql_library_init(), it's already done!
  1394. Oct 27 20:18:14 localhost vdr: scraper2vdr: Set locale to 'de_AT.UTF-8'
  1395. Oct 27 20:18:14 localhost vdr: scraper2vdr: detected UTF-8
  1396. Oct 27 20:18:14 localhost vdr: osd2web: Listener at port (4444) established
  1397. Oct 27 20:18:14 localhost vdr: osd2web: using libwebsocket version '2.4.1 unknown-build-hash'
  1398. Oct 27 20:18:14 localhost vdr: [2047] [live] ERROR: Unable to load cert/key (/var/lib/vdr/plugins/live/live.pem//var/lib/vdr/plugins/live/live-key.pem): Datei oder Verzeichnis nicht gefunden
  1399. Oct 27 20:18:14 localhost vdr: scraper2vdr: Dictionary '/var/lib/vdr/plugins/scraper2vdr/epg.dat' loaded
  1400. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: skindesigner
  1401. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: TrueColor OSD found
  1402. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using libskindesigner API Version 0.1.2
  1403. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: plugin setup uses libskindesigner API Version 0.1.2
  1404. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: plugin setup has registered 1 menus
  1405. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: skinsetup template successfully registered at skindesigner, id 0
  1406. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using Skin Directory /usr/share/vdr/plugins/skindesigner/skins/
  1407. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using Installer Skin Directory /var/lib/vdr/plugins/skindesigner/installerskins/
  1408. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using common ChannelLogo Directory /usr/share/vdr/plugins/skindesigner/logos/
  1409. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using EPG Images Directory /var/cache/vdr/epgimages/
  1410. Oct 27 20:18:14 localhost vdr: [1799] skindesigner 3 skins found in /usr/share/vdr/plugins/skindesigner/skins/
  1411. Oct 27 20:18:14 localhost vdr: [2057] scraper2vdr-update thread started (pid=1799, tid=2057, prio=low)
  1412. Oct 27 20:18:14 localhost vdr: [1799] skindesigner 0 skins found in /var/lib/vdr/plugins/skindesigner/installerskins/
  1413. Oct 27 20:18:14 localhost detect-second-display[2043]: Can't open display :0.1
  1414. Oct 27 20:18:14 localhost systemd[1773]: Started Detect second DISPLAY using xrandr.
  1415. Oct 27 20:18:14 localhost systemd[1773]: Started manage VDR frontends.
  1416. Oct 27 20:18:14 localhost systemd[1773]: Reached target yaVDR Desktop.
  1417. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: skin mynew_estuary started
  1418. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: skin estuary4vdr started
  1419. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: skin metrixhd started
  1420. Oct 27 20:18:15 localhost vdr: [1799] starting plugin: softhddevice
  1421. Oct 27 20:18:15 localhost vdr: [softhddev] ready detached
  1422. Oct 27 20:18:15 localhost vdr: [1799] starting plugin: streamdev-server
  1423. Oct 27 20:18:15 localhost vdr: [1799] loading /var/lib/vdr/plugins/streamdev-server/streamdevhosts.conf
  1424. Oct 27 20:18:15 localhost vdr: [1799] starting plugin: wirbelscan
  1425. Oct 27 20:18:15 localhost vdr: [2064] streamdev server thread started (pid=1799, tid=2064, prio=high)
  1426. Oct 27 20:18:15 localhost vdr: [2064] Streamdev: Listening (VTP) on port 2004
  1427. Oct 27 20:18:15 localhost vdr: [2064] Streamdev: Listening (HTTP) on port 3000
  1428. Oct 27 20:18:15 localhost vdr: [1799] setting current skin to "mynew_estuary"
  1429. Oct 27 20:18:15 localhost vdr: [1799] loading /var/lib/vdr/themes/mynew_estuary-default.theme
  1430. Oct 27 20:18:15 localhost vdr: [1799] remote control LIRC - keys known
  1431. Oct 27 20:18:15 localhost vdr: [2065] LIRC remote control thread started (pid=1799, tid=2065, prio=high)
  1432. Oct 27 20:18:15 localhost vdr: [1799] loading /var/cache/vdr/cam.data
  1433. Oct 27 20:18:15 localhost bash[1749]: ERROR: openbox-xdg-autostart requires PyXDG to be installed
  1434. Oct 27 20:18:15 localhost vdr: [1799] DVBAPI: 0.0: status 'reset'
  1435. Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: 0.0: status 'ready'
  1436. Oct 27 20:18:15 localhost vdr: [1936] CAM 1: module ready
  1437. Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: 1.1: status 'reset'
  1438. Oct 27 20:18:15 localhost vdr: [1936] CAM 2: module reset
  1439. Oct 27 20:18:15 localhost vdr: [1799] DVBAPI: 1.1: status 'ready'
  1440. Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: CaInfo: 0.0 sending CA info
  1441. Oct 27 20:18:15 localhost vdr: [1936] CAM 1: system ids: FFFF
  1442. Oct 27 20:18:15 localhost vdr: [1936] CAM 1: replies to QUERY - multi channel decryption (MCD) possible
  1443. Oct 27 20:18:15 localhost bash[1749]: Typelib for 'libnotify' is not available. Possible causes include:
  1444. Oct 27 20:18:15 localhost bash[1749]: #011- libnotify is not installed
  1445. Oct 27 20:18:15 localhost bash[1749]: #011- the typelib is provided by a separate package
  1446. Oct 27 20:18:15 localhost bash[1749]: #011- libnotify was built with introspection disabled
  1447. Oct 27 20:18:15 localhost bash[1749]: Starting udiskie without notifications.
  1448. Oct 27 20:18:15 localhost snapd[874]: daemon.go:576: gracefully waiting for running hooks
  1449. Oct 27 20:18:15 localhost snapd[874]: daemon.go:578: done waiting for running hooks
  1450. Oct 27 20:18:15 localhost snapd[874]: daemon stop requested to wait for socket activation
  1451. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:yaVDRFrontend:init lirc connection on /var/run/lirc/lircd
  1452. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:init VDRFrontend with name 'VDR-Frontend and fe_typevdr'
  1453. Oct 27 20:18:15 localhost kernel: [ 14.319470] FAT-fs (sdc1): Volume was not properly unmounted. Some data may be corrupt. Please run fsck.
  1454. Oct 27 20:18:15 localhost kernel: [ 14.341696] FAT-fs (sdc3): Volume was not properly unmounted. Some data may be corrupt. Please run fsck.
  1455. Oct 27 20:18:15 localhost yavdr-frontend[2061]: INFO:pydbus2vdr:VDR Status: running
  1456. Oct 27 20:18:15 localhost vdr: [1937] dbus2vdr: thread-pool for handling method-calls started
  1457. Oct 27 20:18:15 localhost systemd[1]: Created slice system-clean\x2dmount\x2dpoint.slice.
  1458. Oct 27 20:18:15 localhost systemd[1]: Started Clean the /media/vdr/3451-ADE2 mount point.
  1459. Oct 27 20:18:15 localhost systemd[1]: Started Clean the /media/vdr/327B-9667 mount point.
  1460. Oct 27 20:18:15 localhost udisksd[879]: Mounted /dev/sdc3 at /media/vdr/3451-ADE2 on behalf of uid 666
  1461. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:init SystemdUnit with name: kodi and fe_type: unit
  1462. Oct 27 20:18:15 localhost bash[1749]: mounted /org/freedesktop/UDisks2/block_devices/sdc3 on /media/vdr/3451-ADE2
  1463. Oct 27 20:18:15 localhost udisksd[879]: Mounted /dev/sdc1 at /media/vdr/327B-9667 on behalf of uid 666
  1464. Oct 27 20:18:15 localhost bash[1749]: mounted /org/freedesktop/UDisks2/block_devices/sdc1 on /media/vdr/327B-9667
  1465. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:set_unit_name: kodi.service
  1466. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:init SystemdUnit with name: firefox and fe_type: app
  1467. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:set_unit_name: app@firefox.service
  1468. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:init SystemdUnit with name: debian-xterm.desktop and fe_type: app
  1469. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:set_unit_name: app@debian\x2dxterm.desktop.service
  1470. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:yaVDRFrontend:set_background with options path: /usr/share/yavdr/images/yavdr_logo.png, fill: False
  1471. Oct 27 20:18:15 localhost vdr: [1936] CAM 2: module ready
  1472. Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: CaInfo: 1.1 sending CA info
  1473. Oct 27 20:18:15 localhost vdr: [1936] CAM 2: system ids: FFFF
  1474. Oct 27 20:18:15 localhost vdr: [1799] CAM 1: ready, master (OSCam)
  1475. Oct 27 20:18:15 localhost vdr: [1799] CAM 2: ready, slave of CAM 1
  1476. Oct 27 20:18:15 localhost vdr: [1799] switching to channel 36 S19.2E-1-1089-12080 (RTLplus)
  1477. Oct 27 20:18:15 localhost vdr: [1799] creating directory /run/shm/vtx
  1478. Oct 27 20:18:15 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1089-12080
  1479. Oct 27 20:18:15 localhost systemd[1]: Started Video Disk Recorder.
  1480. Oct 27 20:18:15 localhost vdr: [1799] [softhddev]SetVolumeDevice: 55
  1481. Oct 27 20:18:15 localhost vdr: [2112] SVDRP server handler thread started (pid=1799, tid=2112, prio=low)
  1482. Oct 27 20:18:15 localhost vdr: [2112] SVDRP myVDR opening port 6419/tcp
  1483. Oct 27 20:18:15 localhost systemd[1]: Started vdr-net-monitor.
  1484. Oct 27 20:18:15 localhost vdr: [2112] SVDRP myVDR listening on port 6419/tcp
  1485. Oct 27 20:18:15 localhost vdr: [2108] device 1 receiver thread started (pid=1799, tid=2108, prio=high)
  1486. Oct 27 20:18:15 localhost vdr: [2111] osdteletext-receiver thread started (pid=1799, tid=2111, prio=high)
  1487. Oct 27 20:18:15 localhost vdr: [2114] device 1 TS buffer thread started (pid=1799, tid=2114, prio=high)
  1488. Oct 27 20:18:15 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1489. Oct 27 20:18:15 localhost vdr: [2124] SVDRP client handler thread started (pid=1799, tid=2124, prio=low)
  1490. Oct 27 20:18:15 localhost vdr: [2124] SVDRP myVDR opening port 6419/udp
  1491. Oct 27 20:18:15 localhost vdr: [2124] SVDRP myVDR listening on port 6419/udp
  1492. Oct 27 20:18:15 localhost vdr: [2124] SVDRP myVDR > 255.255.255.255:6419 send dgram 'SVDRP:discover name:myVDR port:6419 vdrversion:20400 apiversion:20400 timeout:300'
  1493. Oct 27 20:18:15 localhost vdr: [1799] OSD size changed to 1920x1080 @ 1
  1494. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: initializing skin mynew_estuary
  1495. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using decimal point ,
  1496. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using channel logo path /usr/share/vdr/plugins/skindesigner/logos/
  1497. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using icon path /usr/share/vdr/plugins/skindesigner/skins/mynew_estuary/themes/default/
  1498. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using skinparts path /usr/share/vdr/plugins/skindesigner/skins/mynew_estuary/themes/default/skinparts/
  1499. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using svgtemplate path /usr/share/vdr/plugins/skindesigner/skins/mynew_estuary/svgtemplates/
  1500. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using language de_DE
  1501. Oct 27 20:18:15 localhost mount-notification: event: device_mounted, device: /dev/sdc1, mount_path: /media/vdr/327B-9667
  1502. Oct 27 20:18:15 localhost mount-notification: event: device_mounted, device: /dev/sdc3, mount_path: /media/vdr/3451-ADE2
  1503. Oct 27 20:18:15 localhost bash[1749]: ln: Die symbolische Verknüpfung '/srv/vdr/video/327B-9667' konnte nicht angelegt werden: Die Datei existiert bereits
  1504. Oct 27 20:18:15 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
  1505. Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
  1506. Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open timers)
  1507. Oct 27 20:18:15 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
  1508. Oct 27 20:18:15 localhost bash[1749]: ln: Die symbolische Verknüpfung '/srv/vdr/video/3451-ADE2' konnte nicht angelegt werden: Die Datei existiert bereits
  1509. Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
  1510. Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open timers)
  1511. Oct 27 20:18:15 localhost vdr recordings found: mountpoint already exists, aborting
  1512. Oct 27 20:18:15 localhost vdr recordings found: mountpoint already exists, aborting
  1513. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: templates successfully validated and parsed
  1514. Oct 27 20:18:15 localhost vdr: [1799] [softhddev]detached - OpenGl Worker Thread not tried to start
  1515. Oct 27 20:18:19 localhost vdr: message repeated 31 times: [ [1799] [softhddev]detached - OpenGl Worker Thread not tried to start]
  1516. Oct 27 20:18:20 localhost vdr: [1907] video directory scanner thread ended (pid=1799, tid=1907)
  1517. Oct 27 20:18:20 localhost vdr: [1799] [softhddev]detached - OpenGl Worker Thread not tried to start
  1518. Oct 27 20:18:21 localhost vdr: message repeated 49 times: [ [1799] [softhddev]detached - OpenGl Worker Thread not tried to start]
  1519. Oct 27 20:18:21 localhost vdr: [1799] skindesigner: templates and images cached
  1520. Oct 27 20:18:21 localhost vdr: [1799] skindesigner: cached 71 icons - size internal mem 1,79MB, high level mem 0,00MB
  1521. Oct 27 20:18:21 localhost vdr: [1799] skindesigner: cached 601 logos - size 30943,06MB internal mem
  1522. Oct 27 20:18:21 localhost vdr: [1799] skindesigner: cached 11 skinparts - size internal mem 21,89MB, high level mem 0,00MB
  1523. Oct 27 20:18:21 localhost vdr: [1799] skindesigner: templates loaded and caches created - needed 5587 ms
  1524. Oct 27 20:18:21 localhost vdr: [1799] [softhddev]CreateOsd: left 0, top 0, level 0, using OpenGL OSD support
  1525. Oct 27 20:18:21 localhost vdr: [1799] [softhddev]detached - OpenGl Worker Thread not tried to start
  1526. Oct 27 20:18:21 localhost vdr: [1799] [softhddev]OpenGl Thread not started successfully, using Dummy OSD
  1527. Oct 27 20:18:21 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
  1528. Oct 27 20:18:21 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
  1529. Oct 27 20:18:21 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open timers)
  1530. Oct 27 20:18:21 localhost vdr: [2223] animator thread thread started (pid=1799, tid=2223, prio=high)
  1531. Oct 27 20:18:21 localhost yavdr-frontend[2061]: INFO:pydbus2vdr:VDR Status: running
  1532. Oct 27 20:18:21 localhost vdr: [2224] dbus2vdr: use of deprecated interface: 'List' should be called with the interface 'de.tvdr.vdr.pluginmanager'!
  1533. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:False
  1534. Oct 27 20:18:21 localhost yavdr-frontend[2061]: INFO:softhddevice:use_pasuspend is False
  1535. Oct 27 20:18:21 localhost avahi-linker[1162]: 2019-10-27 20:18:21,466 INFO Update recdir via dbus: 0 update of recordings triggered
  1536. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:could not read /var/cache/vdr/acpiwakeup.time: [Errno 2] No such file or directory: '/var/cache/vdr/acpiwakeup.time'
  1537. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:start_t has value StartType.MANUAL
  1538. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:attach_on_startup has value auto
  1539. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:yaVDRFrontend:set_background with options path: /usr/share/yavdr/images/yavdr_logo.png, fill: False
  1540. Oct 27 20:18:21 localhost vdr: [2226] video directory scanner thread started (pid=1799, tid=2226, prio=low)
  1541. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:user is active: True
  1542. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:check_state(): got status code: 912
  1543. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:status: softhddevice is detached
  1544. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:check_state(): got status code: 912
  1545. Oct 27 20:18:21 localhost vdr: [2226] video directory scanner thread ended (pid=1799, tid=2226)
  1546. Oct 27 20:18:21 localhost vdr: video/vdpau: VDPAU API version: 1
  1547. Oct 27 20:18:21 localhost vdr: video/vdpau: VDPAU information: NVIDIA VDPAU Driver Shared Library 390.116 Sun Jan 27 06:28:58 PST 2019
  1548. Oct 27 20:18:21 localhost vdr: video/vdpau: highest supported high quality scaling 1
  1549. Oct 27 20:18:21 localhost vdr: video/vdpau: feature deinterlace temporal supported
  1550. Oct 27 20:18:21 localhost vdr: video/vdpau: feature deinterlace temporal spatial supported
  1551. Oct 27 20:18:21 localhost vdr: video/vdpau: attribute skip chroma deinterlace supported
  1552. Oct 27 20:18:21 localhost vdr: video/vdpau: 4:2:0 chroma format with 4096x4096 supported
  1553. Oct 27 20:18:21 localhost vdr: video/vdpau: 4:2:2 chroma format with 4096x4096 supported
  1554. Oct 27 20:18:21 localhost vdr: video/vdpau: 8bit BGRA format with 16384x16384 supported
  1555. Oct 27 20:18:21 localhost vdr: video/vdpau: 10bit RGBA format with 16384x16384 supported
  1556. Oct 27 20:18:21 localhost vdr: audio: 'alsa' output module used
  1557. Oct 27 20:18:21 localhost vdr: audio/alsa: supports pause: yes
  1558. Oct 27 20:18:21 localhost vdr: [2046] EPGSearch: timer conflict check started
  1559. Oct 27 20:18:21 localhost vdr: [2046] EPGSearch: timer conflict check finished
  1560. Oct 27 20:18:22 localhost vdr: audio: 44100Hz supports 1 2 3 4 5 6 7 8 channels
  1561. Oct 27 20:18:22 localhost vdr: audio: 48000Hz supports 1 2 3 4 5 6 7 8 channels
  1562. Oct 27 20:18:22 localhost vdr: audio: 192000Hz supports 1 2 3 4 5 6 7 8 channels
  1563. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:change_state with command atta and options "-d :0" to attached
  1564. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:check_state(): got status code: 910
  1565. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:softhddevice successfully attached
  1566. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:current PrimaryDevice is softhddevice-openglosd (Index: 2, Number: 2, hasDecoder: True, isPrimary: True)
  1567. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:{self.name} is the primary device
  1568. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:needed 0.001 s to switch primary device
  1569. Oct 27 20:18:22 localhost vdr: audio/alsa: using device 'default'
  1570. Oct 27 20:18:22 localhost vdr: audio/alsa: start delay 336ms
  1571. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2268]: Upgrading MySQL tables if necessary.
  1572. Oct 27 20:18:23 localhost vdr: video/vdpau: synced after 31 frames
  1573. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: /usr/bin/mysql_upgrade: the '--basedir' option is always ignored
  1574. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: Looking for 'mysql' as: /usr/bin/mysql
  1575. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: Looking for 'mysqlcheck' as: /usr/bin/mysqlcheck
  1576. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: This installation of MySQL is already upgraded to 10.1.41-MariaDB, use --force if you still need to run mysql_upgrade
  1577. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2279]: Checking for insecure root accounts.
  1578. Oct 27 20:18:23 localhost vdr: video: slow down video, duping frame
  1579. Oct 27 20:18:23 localhost vdr: video: 5:07:09.955 +105 386 0/\ms 10+7+4 v-buf
  1580. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2283]: Triggering myisam-recover for all MyISAM tables and aria-recover for all Aria tables
  1581. Oct 27 20:18:23 localhost systemd[1]: Started MariaDB 10.1.41 database server.
  1582. Oct 27 20:18:23 localhost systemd[1]: Starting vdr-epg-daemon manages EPG data in a MySQL database...
  1583. Oct 27 20:18:23 localhost epgd: Set locale to 'de_AT.UTF-8'
  1584. Oct 27 20:18:23 localhost epgd: Calling sd_notify(READY=1$STATUS=Ready$MAINPID=2292$)
  1585. Oct 27 20:18:23 localhost systemd[1]: Started vdr-epg-daemon manages EPG data in a MySQL database.
  1586. Oct 27 20:18:23 localhost epgd: Info: Systemd watchdog not configured, epgd won't be sending keep-alive messages!
  1587. Oct 27 20:18:23 localhost systemd[1]: Starting epghttpd provides a webinterface for epg data...
  1588. Oct 27 20:18:23 localhost epgd: Loading uuid from '/etc/epgd/uuid' succeeded [728B3EF7-3164-4835-8CB2-E96D3938FFD2]
  1589. Oct 27 20:18:23 localhost epgd: Dictionary '/etc/epgd/epg.dat' loaded
  1590. Oct 27 20:18:23 localhost epgd: Initialize python script '/etc/epgd/recording.py'
  1591. Oct 27 20:18:23 localhost epghttpd: Set locale to 'de_AT.UTF-8'
  1592. Oct 27 20:18:23 localhost epghttpd: detected UTF-8
  1593. Oct 27 20:18:23 localhost epghttpd: Read 29 option from /etc/epgd/epgd.conf
  1594. Oct 27 20:18:23 localhost epghttpd: Log level is set to (1)
  1595. Oct 27 20:18:23 localhost epghttpd: Initialize python script '/etc/epgd/recording.py'
  1596. Oct 27 20:18:23 localhost epgd: Loading plugin: /usr/lib/epgd/plugins/libepgd-epgdata.so
  1597. Oct 27 20:18:23 localhost epgd: Loading plugin: /usr/lib/epgd/plugins/libepgd-tvm.so
  1598. Oct 27 20:18:23 localhost epgd: Loading plugin: /usr/lib/epgd/plugins/libepgd-tvsp.so
  1599. Oct 27 20:18:23 localhost epgd: Read 29 option from /etc/epgd/epgd.conf
  1600. Oct 27 20:18:23 localhost epgd: Using syslog facility 'user' (8), log level set to (1)
  1601. Oct 27 20:18:23 localhost epgd: Info: Calling mysql_library_init()
  1602. Oct 27 20:18:23 localhost epghttpd: Initialize python script '/etc/epgd/recording.py'
  1603. Oct 27 20:18:23 localhost epgd: Info: Stylesheet '/etc/epgd/epgdata-utf-8.xsl' loaded
  1604. Oct 27 20:18:23 localhost epgd: Info: Stylesheet '/etc/epgd/tvmovie-utf-8.xsl' loaded
  1605. Oct 27 20:18:23 localhost epgd: Info: Stylesheet '/etc/epgd/tvsp-utf-8.xsl' loaded
  1606. Oct 27 20:18:23 localhost epgd: Checking database connection ...
  1607. Oct 27 20:18:23 localhost epgd: Calling mysql_init(2292)
  1608. Oct 27 20:18:23 localhost epghttpd: Dictionary '/etc/epgd/epg.dat' loaded
  1609. Oct 27 20:18:23 localhost epghttpd: Info: Calling mysql_library_init()
  1610. Oct 27 20:18:23 localhost epghttpd: Connecting to database at 'localhost:3306'
  1611. Oct 27 20:18:23 localhost epghttpd: Calling mysql_init(2300)
  1612. Oct 27 20:18:23 localhost epghttpd: SQL client character now 'utf8'
  1613. Oct 27 20:18:23 localhost epgd: SQL client character now 'utf8'
  1614. Oct 27 20:18:23 localhost epgd: Checking table structure and indices ...
  1615. Oct 27 20:18:23 localhost epgd: Checking table 'analyse'
  1616. Oct 27 20:18:23 localhost epgd: Checking table 'channelmap'
  1617. Oct 27 20:18:23 localhost epgd: Checking table 'components'
  1618. Oct 27 20:18:23 localhost epgd: Checking table 'episodes'
  1619. Oct 27 20:18:23 localhost epghttpd: Calling mysql_init(2300)
  1620. Oct 27 20:18:23 localhost epgd: Checking table 'events'
  1621. Oct 27 20:18:23 localhost epghttpd: Starting http server ...
  1622. Oct 27 20:18:23 localhost epghttpd: Listener at port 9999 established, waiting for connections
  1623. Oct 27 20:18:23 localhost systemd[1]: Started epghttpd provides a webinterface for epg data.
  1624. Oct 27 20:18:23 localhost epghttpd: Calling sd_notify(READY=1$STATUS=Ready$MAINPID=2300$)
  1625. Oct 27 20:18:23 localhost systemd[1]: Reached target Multi-User System.
  1626. Oct 27 20:18:23 localhost systemd[1]: Reached target Graphical Interface.
  1627. Oct 27 20:18:23 localhost systemd[1]: Starting Update UTMP about System Runlevel Changes...
  1628. Oct 27 20:18:23 localhost systemd[1]: Started Stop ureadahead data collection 45s after completed startup.
  1629. Oct 27 20:18:23 localhost epghttpd: Info: Systemd watchdog not configured, epgd won't be sending keep-alive messages!
  1630. Oct 27 20:18:23 localhost systemd[1]: Started Update UTMP about System Runlevel Changes.
  1631. Oct 27 20:18:23 localhost systemd[1]: Startup finished in 4.262s (kernel) + 17.816s (userspace) = 22.078s.
  1632. Oct 27 20:18:23 localhost epgd: Checking table 'fileref'
  1633. Oct 27 20:18:23 localhost epgd: Checking table 'imagerefs'
  1634. Oct 27 20:18:23 localhost epgd: Checking table 'images'
  1635. Oct 27 20:18:23 localhost epgd: Checking table 'messages'
  1636. Oct 27 20:18:23 localhost epgd: Checking table 'movie'
  1637. Oct 27 20:18:23 localhost epgd: Checking table 'movie_actor'
  1638. Oct 27 20:18:23 localhost epgd: Checking table 'movie_actors'
  1639. Oct 27 20:18:23 localhost epgd: Checking table 'movie_media'
  1640. Oct 27 20:18:23 localhost epgd: Checking table 'parameters'
  1641. Oct 27 20:18:23 localhost epgd: Checking table 'recordingdirs'
  1642. Oct 27 20:18:23 localhost epgd: Checking table 'recordingimages'
  1643. Oct 27 20:18:23 localhost epgd: Checking table 'recordinglist'
  1644. Oct 27 20:18:23 localhost epgd: Checking table 'searchtimers'
  1645. Oct 27 20:18:23 localhost epgd: Checking table 'series'
  1646. Oct 27 20:18:23 localhost epgd: Checking table 'series_actor'
  1647. Oct 27 20:18:23 localhost epgd: Checking table 'series_episode'
  1648. Oct 27 20:18:23 localhost epgd: Checking table 'series_media'
  1649. Oct 27 20:18:23 localhost epgd: Checking table 'snapshot'
  1650. Oct 27 20:18:23 localhost epgd: Checking table 'timers'
  1651. Oct 27 20:18:23 localhost epgd: Checking table 'timersdone'
  1652. Oct 27 20:18:23 localhost epgd: Checking table 'useevents'
  1653. Oct 27 20:18:23 localhost epgd: Checking table 'users'
  1654. Oct 27 20:18:23 localhost epgd: Checking table 'vdrs'
  1655. Oct 27 20:18:23 localhost epgd: Closing mysql connection and calling mysql_thread_end(2292)
  1656. Oct 27 20:18:23 localhost epgd: Checking table structure and indices succeeded
  1657. Oct 27 20:18:23 localhost epgd: Calling mysql_init(2292)
  1658. Oct 27 20:18:23 localhost epgd: State now 'init'
  1659. Oct 27 20:18:23 localhost epgd: Loading '/etc/epgd/channelmap.conf'
  1660. Oct 27 20:18:23 localhost epgd: 343 channel mappings read.
  1661. Oct 27 20:18:23 localhost epgd: Calling mysql_init(2292)
  1662. Oct 27 20:18:23 localhost epgd: Using scraping language de
  1663. Oct 27 20:18:24 localhost epgd: TVDB scraper connected
  1664. Oct 27 20:18:25 localhost vdr: scraper2vdr: Got UUID 'EAF88110-7274-4A43-857C-FF31EC9605E1' by epg2vdr
  1665. Oct 27 20:18:25 localhost vdr: scraper2vdr: Trying to re-connect to database!
  1666. Oct 27 20:18:25 localhost vdr: scraper2vdr: Calling mysql_init(2057)
  1667. Oct 27 20:18:25 localhost vdr: scraper2vdr: SQL client character now 'utf8'
  1668. Oct 27 20:18:25 localhost vdr: scraper2vdr: Connection established successfull!
  1669. Oct 27 20:18:26 localhost vdr: [2223] animator thread thread ended (pid=1799, tid=2223)
  1670. Oct 27 20:18:26 localhost epgd: MOVIEDB scraper connected
  1671. Oct 27 20:18:26 localhost epgd: Scheduled next update in 10 second(s)
  1672. Oct 27 20:18:26 localhost epgd: State now 'standby'
  1673. Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 client connection accepted
  1674. Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR > 192.168.192.150:43208 server created
  1675. Oct 27 20:18:26 localhost epgd: Send 'PLUG epg2vdr STATE standby' to '192.168.192.150:6419'
  1676. Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 lost connection to client
  1677. Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 connection closed
  1678. Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 server destroyed
  1679. Oct 27 20:18:27 localhost epgd: TCC: Starting timer conflict check
  1680. Oct 27 20:18:27 localhost epgd: TCC: Finished timer conflict check with (0) conflicts
  1681. Oct 27 20:18:27 localhost epgd: Checking timers against actual epg and searchtimer settings
  1682. Oct 27 20:18:27 localhost epgd: Timers check done
  1683. Oct 27 20:18:27 localhost epgd: AUTOTIMER: Updating searchtimers due to 'search timer changed'
  1684. Oct 27 20:18:27 localhost epgd: AUTOTIMER: Update done after 0 ms, created (0) timers
  1685. Oct 27 20:18:28 localhost vdr: scraper2vdr: Got 30409 new scraped Events from Database
  1686. Oct 27 20:18:28 localhost vdr: scraper2vdr: Loading Movies information from Database...
  1687. Oct 27 20:18:29 localhost vdr: scraper2vdr: Got 533 new/updated Movies in 1s from Database (new max scrsp: 1572165187)
  1688. Oct 27 20:18:29 localhost vdr: scraper2vdr: Loading Movies content from Database...
  1689. Oct 27 20:18:30 localhost vdr: [1799] [softhddev]CreateOsd: left 0, top 0, level 0, using OpenGL OSD support
  1690. Oct 27 20:18:30 localhost vdr: [1799] [softhddev]Trying to start OpenGL Worker Thread
  1691. Oct 27 20:18:30 localhost vdr: [2415] oglThread thread started (pid=1799, tid=2415, prio=high)
  1692. Oct 27 20:18:30 localhost vdr: [2415] [softhddev]OpenGL using display :0
  1693. Oct 27 20:18:31 localhost vdr: [2415] [softhddev]OpenGL Context initialized
  1694. Oct 27 20:18:31 localhost vdr: [2415] [softhddev]Shaders initialized
  1695. Oct 27 20:18:31 localhost vdr: [2415] [softhddev]vdpau interop initialized
  1696. Oct 27 20:18:31 localhost vdr: [2415] [softhddev]Vertex buffers initialized
  1697. Oct 27 20:18:31 localhost vdr: [2415] [softhddev]Maximum Pixmap size: 16384x16384px
  1698. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]OpenGL Worker Thread successfully started
  1699. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]cOglOsd osdLeft 0 osdTop 0 screenWidth 1920 screenHeight 1080
  1700. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1701. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1702. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1703. Oct 27 20:18:31 localhost vdr: [1799] switching to channel 35 S19.2E-1-1107-17505 (Pro7 MAXX)
  1704. Oct 27 20:18:31 localhost vdr: [2111] osdteletext-receiver thread ended (pid=1799, tid=2111)
  1705. Oct 27 20:18:31 localhost vdr: [1799] buffer stats: 0 (0%) used
  1706. Oct 27 20:18:31 localhost vdr: [2114] device 1 TS buffer thread ended (pid=1799, tid=2114)
  1707. Oct 27 20:18:31 localhost vdr: [2108] buffer stats: 83096 (1%) used
  1708. Oct 27 20:18:31 localhost vdr: [2108] device 1 receiver thread ended (pid=1799, tid=2108)
  1709. Oct 27 20:18:31 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1107-17505
  1710. Oct 27 20:18:31 localhost vdr: [2417] device 1 receiver thread started (pid=1799, tid=2417, prio=high)
  1711. Oct 27 20:18:31 localhost vdr: [2418] osdteletext-receiver thread started (pid=1799, tid=2418, prio=high)
  1712. Oct 27 20:18:31 localhost vdr: [2420] device 1 TS buffer thread started (pid=1799, tid=2420, prio=high)
  1713. Oct 27 20:18:31 localhost vdr: epg2vdr: Answer 'Epg2Vdr_Timer_Service-v1.0' call with 0 timers, duration was (1 ms)
  1714. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1715. Oct 27 20:18:31 localhost vdr: [2421] animator thread thread started (pid=1799, tid=2421, prio=high)
  1716. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1717. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1718. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1719. Oct 27 20:18:31 localhost vdr: [1799] switching to channel 35 S19.2E-1-1107-17505 (Pro7 MAXX)
  1720. Oct 27 20:18:31 localhost vdr: [2418] osdteletext-receiver thread ended (pid=1799, tid=2418)
  1721. Oct 27 20:18:31 localhost vdr: video: slow down video, duping frame
  1722. Oct 27 20:18:31 localhost vdr: video: decoder buffer empty, duping frame (5/420) 0 v-buf
  1723. Oct 27 20:18:31 localhost vdr: video: --:--:--.--- +0 0 0/\ms 0+5+4 v-buf
  1724. Oct 27 20:18:31 localhost vdr: [1799] buffer stats: 0 (0%) used
  1725. Oct 27 20:18:31 localhost vdr: [2420] device 1 TS buffer thread ended (pid=1799, tid=2420)
  1726. Oct 27 20:18:31 localhost vdr: [2417] buffer stats: 0 (0%) used
  1727. Oct 27 20:18:31 localhost vdr: [2417] device 1 receiver thread ended (pid=1799, tid=2417)
  1728. Oct 27 20:18:31 localhost vdr: [2424] osdteletext-receiver thread started (pid=1799, tid=2424, prio=high)
  1729. Oct 27 20:18:31 localhost vdr: [2423] device 1 receiver thread started (pid=1799, tid=2423, prio=high)
  1730. Oct 27 20:18:31 localhost vdr: [2425] device 1 TS buffer thread started (pid=1799, tid=2425, prio=high)
  1731. Oct 27 20:18:31 localhost vdr: scraper2vdr: Got 0 new/updated Image information in 2s from Database
  1732. Oct 27 20:18:31 localhost vdr: scraper2vdr: Loading Series information from Database...
  1733. Oct 27 20:18:31 localhost vdr: [1799] switching to channel 32 S19.2E-1-1003-13223 (ATV2)
  1734. Oct 27 20:18:31 localhost vdr: [2424] osdteletext-receiver thread ended (pid=1799, tid=2424)
  1735. Oct 27 20:18:31 localhost vdr: [1799] buffer stats: 0 (0%) used
  1736. Oct 27 20:18:31 localhost vdr: [2425] device 1 TS buffer thread ended (pid=1799, tid=2425)
  1737. Oct 27 20:18:31 localhost vdr: [2423] buffer stats: 50384 (0%) used
  1738. Oct 27 20:18:31 localhost vdr: [2423] device 1 receiver thread ended (pid=1799, tid=2423)
  1739. Oct 27 20:18:31 localhost vdr: [1799] CAM 1: assigned to device 1
  1740. Oct 27 20:18:31 localhost vdr: [2427] device 1 receiver thread started (pid=1799, tid=2427, prio=high)
  1741. Oct 27 20:18:31 localhost vdr: [2428] device 1 TS buffer thread started (pid=1799, tid=2428, prio=high)
  1742. Oct 27 20:18:32 localhost vdr: [1799] DVBAPI: 0.0 set CAM decrypt (SID 13223 (0x33A7), caLm 5, HasCaDescriptors 0)
  1743. Oct 27 20:18:32 localhost vdr: [1799] DVBAPI: 0.0 set CAM decrypt (SID 13223 (0x33A7), caLm 4, HasCaDescriptors 0)
  1744. Oct 27 20:18:32 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1003-13223
  1745. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1746. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1747. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1748. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1749. Oct 27 20:18:32 localhost vdr: [1799] DVBAPI: 0.0 set CAM decrypt (SID 13223 (0x33A7), caLm 5, HasCaDescriptors 0)
  1750. Oct 27 20:18:32 localhost vdr: [1799] CAM 1: unassigned from device 1
  1751. Oct 27 20:18:32 localhost vdr: [1799] switching to channel 31 S19.2E-1-1039-10378 (SR Fernsehen HD)
  1752. Oct 27 20:18:32 localhost vdr: [2429] osdteletext-receiver thread started (pid=1799, tid=2429, prio=high)
  1753. Oct 27 20:18:32 localhost vdr: [2429] osdteletext-receiver thread ended (pid=1799, tid=2429)
  1754. Oct 27 20:18:32 localhost vdr: [1799] buffer stats: 0 (0%) used
  1755. Oct 27 20:18:32 localhost vdr: [2428] device 1 TS buffer thread ended (pid=1799, tid=2428)
  1756. Oct 27 20:18:32 localhost vdr: [2427] buffer stats: 0 (0%) used
  1757. Oct 27 20:18:32 localhost vdr: [2427] device 1 receiver thread ended (pid=1799, tid=2427)
  1758. Oct 27 20:18:32 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1039-10378
  1759. Oct 27 20:18:32 localhost vdr: [2433] osdteletext-receiver thread started (pid=1799, tid=2433, prio=high)
  1760. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1761. Oct 27 20:18:32 localhost vdr: [2432] device 1 receiver thread started (pid=1799, tid=2432, prio=high)
  1762. Oct 27 20:18:32 localhost vdr: [2434] device 1 TS buffer thread started (pid=1799, tid=2434, prio=high)
  1763. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1764. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1765. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1766. Oct 27 20:18:32 localhost vdr: [1799] switching to channel 30 S19.2E-1-1025-10329 (NDR FS HH HD)
  1767. Oct 27 20:18:32 localhost vdr: [2433] osdteletext-receiver thread ended (pid=1799, tid=2433)
  1768. Oct 27 20:18:32 localhost vdr: [1799] buffer stats: 0 (0%) used
  1769. Oct 27 20:18:32 localhost vdr: [2434] device 1 TS buffer thread ended (pid=1799, tid=2434)
  1770. Oct 27 20:18:32 localhost vdr: [2432] buffer stats: 0 (0%) used
  1771. Oct 27 20:18:32 localhost vdr: [2432] device 1 receiver thread ended (pid=1799, tid=2432)
  1772. Oct 27 20:18:32 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1025-10329
  1773. Oct 27 20:18:32 localhost vdr: [2436] osdteletext-receiver thread started (pid=1799, tid=2436, prio=high)
  1774. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1775. Oct 27 20:18:32 localhost vdr: [2435] device 1 receiver thread started (pid=1799, tid=2435, prio=high)
  1776. Oct 27 20:18:32 localhost vdr: [2437] device 1 TS buffer thread started (pid=1799, tid=2437, prio=high)
  1777. Oct 27 20:18:33 localhost vdr: audio/alsa: using device 'default'
  1778. Oct 27 20:18:33 localhost vdr: audio/alsa: start delay 600ms
  1779. Oct 27 20:18:33 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1780. Oct 27 20:18:33 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1781. Oct 27 20:18:33 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1782. Oct 27 20:18:33 localhost vdr: [1799] switching to channel 29 S19.2E-1-1061-10351 (rbb Berlin HD)
  1783. Oct 27 20:18:33 localhost vdr: scraper2vdr: Got 783 new/updated Series in 2s from Database (new max scrsp: 1572165173)
  1784. Oct 27 20:18:33 localhost vdr: scraper2vdr: Loading Series content from Database...
  1785. Oct 27 20:18:33 localhost vdr: [2436] osdteletext-receiver thread ended (pid=1799, tid=2436)
  1786. Oct 27 20:18:33 localhost vdr: [1799] buffer stats: 0 (0%) used
  1787. Oct 27 20:18:33 localhost vdr: [2437] device 1 TS buffer thread ended (pid=1799, tid=2437)
  1788. Oct 27 20:18:33 localhost vdr: [2435] buffer stats: 149272 (2%) used
  1789. Oct 27 20:18:33 localhost vdr: [2435] device 1 receiver thread ended (pid=1799, tid=2435)
  1790. Oct 27 20:18:33 localhost vdr: [2633] device 1 receiver thread started (pid=1799, tid=2633, prio=high)
  1791. Oct 27 20:18:33 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1061-10351
  1792. Oct 27 20:18:33 localhost vdr: [2634] osdteletext-receiver thread started (pid=1799, tid=2634, prio=high)
  1793. Oct 27 20:18:33 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1794. Oct 27 20:18:33 localhost vdr: [2635] device 1 TS buffer thread started (pid=1799, tid=2635, prio=high)
  1795. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1796. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1797. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1798. Oct 27 20:18:34 localhost vdr: [1799] switching to channel 28 S19.2E-1-1019-10303 (SWR BW HD)
  1799. Oct 27 20:18:34 localhost vdr: [2634] osdteletext-receiver thread ended (pid=1799, tid=2634)
  1800. Oct 27 20:18:34 localhost vdr: [1799] buffer stats: 0 (0%) used
  1801. Oct 27 20:18:34 localhost vdr: [2635] device 1 TS buffer thread ended (pid=1799, tid=2635)
  1802. Oct 27 20:18:34 localhost vdr: [2633] buffer stats: 81404 (1%) used
  1803. Oct 27 20:18:34 localhost vdr: [2633] device 1 receiver thread ended (pid=1799, tid=2633)
  1804. Oct 27 20:18:34 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1019-10303
  1805. Oct 27 20:18:34 localhost vdr: [2639] osdteletext-receiver thread started (pid=1799, tid=2639, prio=high)
  1806. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1807. Oct 27 20:18:34 localhost vdr: [2638] device 1 receiver thread started (pid=1799, tid=2638, prio=high)
  1808. Oct 27 20:18:34 localhost vdr: [2640] device 1 TS buffer thread started (pid=1799, tid=2640, prio=high)
  1809. Oct 27 20:18:34 localhost vdr: [softhddev] invalid PES video packet
  1810. Oct 27 20:18:34 localhost vdr: audio/alsa: using device 'default'
  1811. Oct 27 20:18:34 localhost vdr: audio/alsa: start delay 600ms
  1812. Oct 27 20:18:34 localhost vdr: [softhddev] 3 invalid PES video packet(s)
  1813. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1814. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1815. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1816. Oct 27 20:18:34 localhost vdr: [1799] switching to channel 27 S19.2E-1-1101-28111 (WDR Köln)
  1817. Oct 27 20:18:34 localhost vdr: [2639] osdteletext-receiver thread ended (pid=1799, tid=2639)
  1818. Oct 27 20:18:34 localhost vdr: [1799] buffer stats: 0 (0%) used
  1819. Oct 27 20:18:34 localhost vdr: [2640] device 1 TS buffer thread ended (pid=1799, tid=2640)
  1820. Oct 27 20:18:34 localhost vdr: [2638] buffer stats: 171080 (3%) used
  1821. Oct 27 20:18:34 localhost vdr: [2638] device 1 receiver thread ended (pid=1799, tid=2638)
  1822. Oct 27 20:18:34 localhost vdr: [2643] device 1 receiver thread started (pid=1799, tid=2643, prio=high)
  1823. Oct 27 20:18:34 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1101-28111
  1824. Oct 27 20:18:34 localhost vdr: [2645] osdteletext-receiver thread started (pid=1799, tid=2645, prio=high)
  1825. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1826. Oct 27 20:18:34 localhost vdr: [2644] device 1 TS buffer thread started (pid=1799, tid=2644, prio=high)
  1827. Oct 27 20:18:35 localhost vdr: audio/alsa: using device 'default'
  1828. Oct 27 20:18:35 localhost vdr: audio/alsa: start delay 600ms
  1829. Oct 27 20:18:35 localhost vdr: [softhddev] invalid PES video packet
  1830. Oct 27 20:18:35 localhost vdr: [softhddev] 2 invalid PES video packet(s)
  1831. Oct 27 20:18:35 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1832. Oct 27 20:18:35 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1833. Oct 27 20:18:35 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1834. Oct 27 20:18:35 localhost vdr: [1799] switching to channel 26 S19.2E-1-1061-10355 (hr-fernsehen HD)
  1835. Oct 27 20:18:35 localhost vdr: [2645] osdteletext-receiver thread ended (pid=1799, tid=2645)
  1836. Oct 27 20:18:35 localhost vdr: [1799] buffer stats: 0 (0%) used
  1837. Oct 27 20:18:35 localhost vdr: [2644] device 1 TS buffer thread ended (pid=1799, tid=2644)
  1838. Oct 27 20:18:35 localhost vdr: [2643] buffer stats: 70124 (1%) used
  1839. Oct 27 20:18:35 localhost vdr: [2643] device 1 receiver thread ended (pid=1799, tid=2643)
  1840. Oct 27 20:18:35 localhost vdr: [2648] device 1 receiver thread started (pid=1799, tid=2648, prio=high)
  1841. Oct 27 20:18:35 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1061-10355
  1842. Oct 27 20:18:35 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1843. Oct 27 20:18:35 localhost vdr: [2649] device 1 TS buffer thread started (pid=1799, tid=2649, prio=high)
  1844. Oct 27 20:18:35 localhost vdr: [2650] osdteletext-receiver thread started (pid=1799, tid=2650, prio=high)
  1845. Oct 27 20:18:36 localhost vdr: audio/alsa: using device 'default'
  1846. Oct 27 20:18:36 localhost vdr: audio/alsa: start delay 600ms
  1847. Oct 27 20:18:36 localhost epgd: State now 'busy (events)'
  1848. Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 client connection accepted
  1849. Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR > 192.168.192.150:43210 server created
  1850. Oct 27 20:18:36 localhost epgd: Send 'PLUG epg2vdr STATE busy (events)' to '192.168.192.150:6419'
  1851. Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 lost connection to client
  1852. Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 connection closed
  1853. Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 server destroyed
  1854. Oct 27 20:18:36 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1855. Oct 27 20:18:36 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1856. Oct 27 20:18:36 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1857. Oct 27 20:18:36 localhost vdr: [1799] switching to channel 25 S19.2E-1-1061-10353 (MDR S-Anhalt HD)
  1858. Oct 27 20:18:36 localhost vdr: [2650] osdteletext-receiver thread ended (pid=1799, tid=2650)
  1859. Oct 27 20:18:36 localhost vdr: [1799] buffer stats: 0 (0%) used
  1860. Oct 27 20:18:37 localhost vdr: [2649] device 1 TS buffer thread ended (pid=1799, tid=2649)
  1861. Oct 27 20:18:37 localhost vdr: [2648] buffer stats: 214132 (4%) used
  1862. Oct 27 20:18:37 localhost vdr: [2648] device 1 receiver thread ended (pid=1799, tid=2648)
  1863. Oct 27 20:18:37 localhost vdr: [2655] device 1 receiver thread started (pid=1799, tid=2655, prio=high)
  1864. Oct 27 20:18:37 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1061-10353
  1865. Oct 27 20:18:37 localhost vdr: [2657] osdteletext-receiver thread started (pid=1799, tid=2657, prio=high)
  1866. Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1867. Oct 27 20:18:37 localhost vdr: [2656] device 1 TS buffer thread started (pid=1799, tid=2656, prio=high)
  1868. Oct 27 20:18:37 localhost vdr: audio/alsa: using device 'default'
  1869. Oct 27 20:18:37 localhost vdr: audio/alsa: start delay 600ms
  1870. Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1871. Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1872. Oct 27 20:18:37 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1873. Oct 27 20:18:37 localhost vdr: [1799] switching to channel 24 S19.2E-133-5-772 (TLC)
  1874. Oct 27 20:18:37 localhost vdr: [2657] osdteletext-receiver thread ended (pid=1799, tid=2657)
  1875. Oct 27 20:18:37 localhost vdr: [1799] buffer stats: 0 (0%) used
  1876. Oct 27 20:18:37 localhost vdr: [2656] device 1 TS buffer thread ended (pid=1799, tid=2656)
  1877. Oct 27 20:18:37 localhost vdr: [2655] buffer stats: 131412 (2%) used
  1878. Oct 27 20:18:37 localhost vdr: [2655] device 1 receiver thread ended (pid=1799, tid=2655)
  1879. Oct 27 20:18:37 localhost vdr: [2660] device 1 receiver thread started (pid=1799, tid=2660, prio=high)
  1880. Oct 27 20:18:37 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-133-5-772
  1881. Oct 27 20:18:37 localhost vdr: [2661] device 1 TS buffer thread started (pid=1799, tid=2661, prio=high)
  1882. Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1883. Oct 27 20:18:37 localhost vdr: [2662] osdteletext-receiver thread started (pid=1799, tid=2662, prio=high)
  1884. Oct 27 20:18:38 localhost vdr: scraper2vdr: Got 3630 new/updated Episodes and 2267 new/updated Image information (including 1794 possible not available season poster) in 5s from Database
  1885. Oct 27 20:18:38 localhost vdr: scraper2vdr: Loading Image content from Database...
  1886. Oct 27 20:18:38 localhost vdr: audio/alsa: using device 'default'
  1887. Oct 27 20:18:38 localhost vdr: audio/alsa: start delay 600ms
  1888. Oct 27 20:18:38 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1889. Oct 27 20:18:38 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1890. Oct 27 20:18:38 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1891. Oct 27 20:18:38 localhost vdr: [1799] switching to channel 23 S19.2E-1-1115-13106 (sixx Austria)
  1892. Oct 27 20:18:38 localhost vdr: [2662] osdteletext-receiver thread ended (pid=1799, tid=2662)
  1893. Oct 27 20:18:38 localhost vdr: [1799] buffer stats: 0 (0%) used
  1894. Oct 27 20:18:38 localhost vdr: [2661] device 1 TS buffer thread ended (pid=1799, tid=2661)
  1895. Oct 27 20:18:38 localhost vdr: [2660] buffer stats: 51324 (0%) used
  1896. Oct 27 20:18:38 localhost vdr: [2660] device 1 receiver thread ended (pid=1799, tid=2660)
  1897. Oct 27 20:18:38 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1115-13106
  1898. Oct 27 20:18:38 localhost vdr: [2667] osdteletext-receiver thread started (pid=1799, tid=2667, prio=high)
  1899. Oct 27 20:18:38 localhost vdr: [2666] device 1 receiver thread started (pid=1799, tid=2666, prio=high)
  1900. Oct 27 20:18:38 localhost vdr: [2668] device 1 TS buffer thread started (pid=1799, tid=2668, prio=high)
  1901. Oct 27 20:18:38 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1902. Oct 27 20:18:38 localhost epgd: Starting cleanup of events
  1903. Oct 27 20:18:38 localhost epgd: Delete fileref [substr(name,1,8) <= '20191026' and source = 'epgdata']
  1904. Oct 27 20:18:38 localhost epgd: Delete events [starttime+duration < 1572182318]
  1905. Oct 27 20:18:39 localhost vdr: audio/alsa: using device 'default'
  1906. Oct 27 20:18:39 localhost vdr: audio/alsa: start delay 600ms
  1907. Oct 27 20:18:39 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1908. Oct 27 20:18:39 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1909. Oct 27 20:18:39 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1910. Oct 27 20:18:39 localhost vdr: [1799] switching to channel 22 S19.2E-133-33-51 (TELE 5)
  1911. Oct 27 20:18:39 localhost vdr: [2667] osdteletext-receiver thread ended (pid=1799, tid=2667)
  1912. Oct 27 20:18:39 localhost vdr: [1799] buffer stats: 0 (0%) used
  1913. Oct 27 20:18:39 localhost vdr: [2668] device 1 TS buffer thread ended (pid=1799, tid=2668)
  1914. Oct 27 20:18:39 localhost vdr: [2666] buffer stats: 42112 (0%) used
  1915. Oct 27 20:18:39 localhost vdr: [2666] device 1 receiver thread ended (pid=1799, tid=2666)
  1916. Oct 27 20:18:39 localhost vdr: [2682] device 1 receiver thread started (pid=1799, tid=2682, prio=high)
  1917. Oct 27 20:18:39 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-133-33-51
  1918. Oct 27 20:18:39 localhost vdr: [2683] device 1 TS buffer thread started (pid=1799, tid=2683, prio=high)
  1919. Oct 27 20:18:39 localhost vdr: [2684] osdteletext-receiver thread started (pid=1799, tid=2684, prio=high)
  1920. Oct 27 20:18:39 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1921. Oct 27 20:18:40 localhost vdr: audio/alsa: using device 'default'
  1922. Oct 27 20:18:40 localhost vdr: audio/alsa: start delay 600ms
  1923. Oct 27 20:18:40 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1924. Oct 27 20:18:40 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1925. Oct 27 20:18:40 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1926. Oct 27 20:18:40 localhost vdr: [1799] switching to channel 21 S19.2E-133-5-764 (ANIXE+)
  1927. Oct 27 20:18:40 localhost vdr: [2684] osdteletext-receiver thread ended (pid=1799, tid=2684)
  1928. Oct 27 20:18:40 localhost vdr: [1799] buffer stats: 0 (0%) used
  1929. Oct 27 20:18:40 localhost vdr: [2683] device 1 TS buffer thread ended (pid=1799, tid=2683)
  1930. Oct 27 20:18:40 localhost vdr: [2682] buffer stats: 30456 (0%) used
  1931. Oct 27 20:18:40 localhost vdr: [2682] device 1 receiver thread ended (pid=1799, tid=2682)
  1932. Oct 27 20:18:40 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1933. Oct 27 20:18:40 localhost vdr: [2688] device 1 receiver thread started (pid=1799, tid=2688, prio=high)
  1934. Oct 27 20:18:40 localhost vdr: [2689] device 1 TS buffer thread started (pid=1799, tid=2689, prio=high)
  1935. Oct 27 20:18:40 localhost vdr: audio/alsa: using device 'default'
  1936. Oct 27 20:18:40 localhost vdr: audio/alsa: start delay 600ms
  1937. Oct 27 20:18:40 localhost epgd: Delete useevents [cnt_starttime+cnt_duration < 1572182318]
  1938. Oct 27 20:18:40 localhost epgd: SQL-Error in 'delete from useevents where cnt_starttime+cnt_duration < 1572182318' - Index useevents is corrupted (1712)
  1939. Oct 27 20:18:40 localhost epgd: SQL-Error in 'deleteWhere()' - Index useevents is corrupted (1712) '' [delete from useevents where cnt_starttime+cnt_duration < 1572182318]
  1940. Oct 27 20:18:41 localhost epgd: Cleanup of events finished
  1941. Oct 27 20:18:41 localhost epgd: Starting cleanup of failed timer actions, older than 10 days
  1942. Oct 27 20:18:41 localhost epgd: Cleanup of timer actions finished
  1943. Oct 27 20:18:41 localhost epgd: Calling sd_notify(STATUS=Busy, started Update)
  1944. Oct 27 20:18:41 localhost epgd: EPG Update started
  1945. Oct 27 20:18:41 localhost epgd: Updating 'tvm' day today+0 now
  1946. Oct 27 20:18:41 localhost epgd: Checking tvm id 1
  1947. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1948. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1949. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1950. Oct 27 20:18:41 localhost vdr: [1799] switching to channel 20 S19.2E-1-1019-10302 (arte HD)
  1951. Oct 27 20:18:41 localhost vdr: [2689] device 1 TS buffer thread ended (pid=1799, tid=2689)
  1952. Oct 27 20:18:41 localhost vdr: [2688] buffer stats: 43240 (0%) used
  1953. Oct 27 20:18:41 localhost vdr: [2688] device 1 receiver thread ended (pid=1799, tid=2688)
  1954. Oct 27 20:18:41 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1019-10302
  1955. Oct 27 20:18:41 localhost vdr: [2694] device 1 receiver thread started (pid=1799, tid=2694, prio=high)
  1956. Oct 27 20:18:41 localhost vdr: [2696] device 1 TS buffer thread started (pid=1799, tid=2696, prio=high)
  1957. Oct 27 20:18:41 localhost vdr: [2695] osdteletext-receiver thread started (pid=1799, tid=2695, prio=high)
  1958. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1959. Oct 27 20:18:41 localhost vdr: audio/alsa: using device 'default'
  1960. Oct 27 20:18:41 localhost vdr: audio/alsa: start delay 600ms
  1961. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1962. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1963. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1964. Oct 27 20:18:41 localhost vdr: [1799] switching to channel 20 S19.2E-1-1019-10302 (arte HD)
  1965. Oct 27 20:18:41 localhost vdr: [2695] osdteletext-receiver thread ended (pid=1799, tid=2695)
  1966. Oct 27 20:18:41 localhost vdr: [1799] buffer stats: 0 (0%) used
  1967. Oct 27 20:18:41 localhost vdr: [2696] device 1 TS buffer thread ended (pid=1799, tid=2696)
  1968. Oct 27 20:18:41 localhost vdr: [2694] buffer stats: 153972 (2%) used
  1969. Oct 27 20:18:41 localhost vdr: [2694] device 1 receiver thread ended (pid=1799, tid=2694)
  1970. Oct 27 20:18:41 localhost vdr: [2699] osdteletext-receiver thread started (pid=1799, tid=2699, prio=high)
  1971. Oct 27 20:18:41 localhost vdr: [2698] device 1 receiver thread started (pid=1799, tid=2698, prio=high)
  1972. Oct 27 20:18:41 localhost vdr: [2700] device 1 TS buffer thread started (pid=1799, tid=2700, prio=high)
  1973. Oct 27 20:18:41 localhost vdr: [1799] switching to channel 19 S19.2E-133-33-63 (DMAX)
  1974. Oct 27 20:18:41 localhost vdr: [2699] osdteletext-receiver thread ended (pid=1799, tid=2699)
  1975. Oct 27 20:18:41 localhost vdr: [1799] buffer stats: 0 (0%) used
  1976. Oct 27 20:18:42 localhost vdr: [2700] device 1 TS buffer thread ended (pid=1799, tid=2700)
  1977. Oct 27 20:18:42 localhost vdr: [2698] buffer stats: 160552 (3%) used
  1978. Oct 27 20:18:42 localhost vdr: [2698] device 1 receiver thread ended (pid=1799, tid=2698)
  1979. Oct 27 20:18:42 localhost vdr: [2702] device 1 receiver thread started (pid=1799, tid=2702, prio=high)
  1980. Oct 27 20:18:42 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-133-33-63
  1981. Oct 27 20:18:42 localhost vdr: [2704] osdteletext-receiver thread started (pid=1799, tid=2704, prio=high)
  1982. Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1983. Oct 27 20:18:42 localhost vdr: [2703] device 1 TS buffer thread started (pid=1799, tid=2703, prio=high)
  1984. Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1985. Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1986. Oct 27 20:18:42 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1987. Oct 27 20:18:42 localhost vdr: [1799] switching to channel 18 S19.2E-1-1089-12040 (SUPER RTL)
  1988. Oct 27 20:18:42 localhost vdr: [2704] osdteletext-receiver thread ended (pid=1799, tid=2704)
  1989. Oct 27 20:18:42 localhost vdr: [1799] buffer stats: 0 (0%) used
  1990. Oct 27 20:18:42 localhost vdr: [2703] device 1 TS buffer thread ended (pid=1799, tid=2703)
  1991. Oct 27 20:18:42 localhost vdr: [2702] buffer stats: 0 (0%) used
  1992. Oct 27 20:18:42 localhost vdr: [2702] device 1 receiver thread ended (pid=1799, tid=2702)
  1993. Oct 27 20:18:42 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1089-12040
  1994. Oct 27 20:18:42 localhost vdr: [2707] osdteletext-receiver thread started (pid=1799, tid=2707, prio=high)
  1995. Oct 27 20:18:42 localhost vdr: [2706] device 1 receiver thread started (pid=1799, tid=2706, prio=high)
  1996. Oct 27 20:18:42 localhost vdr: [2708] device 1 TS buffer thread started (pid=1799, tid=2708, prio=high)
  1997. Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1998. Oct 27 20:18:42 localhost vdr: scraper2vdr: Got 528 new/updated Images (found 1739 not available images) in 4s from Database
  1999. Oct 27 20:18:42 localhost epgd: Checking tvm id 11
  2000. Oct 27 20:18:42 localhost systemd-timesyncd[762]: Synchronized to time server 91.189.89.199:123 (ntp.ubuntu.com).
  2001. Oct 27 20:18:42 localhost epgd: Checking tvm id 111
  2002. Oct 27 20:18:42 localhost epgd: Checking tvm id 12
  2003. Oct 27 20:18:42 localhost vdr: audio/alsa: using device 'default'
  2004. Oct 27 20:18:42 localhost vdr: audio/alsa: start delay 600ms
  2005. Oct 27 20:18:43 localhost vdr: [softhddev] invalid PES video packet
  2006. Oct 27 20:18:43 localhost vdr: [softhddev] 2 invalid PES video packet(s)
  2007. Oct 27 20:18:43 localhost epgd: Checking tvm id 129
  2008. Oct 27 20:18:43 localhost epgd: Checking tvm id 13
  2009. Oct 27 20:18:43 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2010. Oct 27 20:18:43 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2011. Oct 27 20:18:43 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2012. Oct 27 20:18:43 localhost vdr: [1799] switching to channel 17 S19.2E-1-1091-28805 (VOX Austria)
  2013. Oct 27 20:18:43 localhost vdr: [2707] osdteletext-receiver thread ended (pid=1799, tid=2707)
  2014. Oct 27 20:18:43 localhost vdr: [1799] buffer stats: 0 (0%) used
  2015. Oct 27 20:18:43 localhost vdr: [2708] device 1 TS buffer thread ended (pid=1799, tid=2708)
  2016. Oct 27 20:18:43 localhost vdr: [2706] buffer stats: 55272 (1%) used
  2017. Oct 27 20:18:43 localhost vdr: [2706] device 1 receiver thread ended (pid=1799, tid=2706)
  2018. Oct 27 20:18:43 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1091-28805
  2019. Oct 27 20:18:43 localhost vdr: [2713] osdteletext-receiver thread started (pid=1799, tid=2713, prio=high)
  2020. Oct 27 20:18:43 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2021. Oct 27 20:18:43 localhost vdr: [2712] device 1 receiver thread started (pid=1799, tid=2712, prio=high)
  2022. Oct 27 20:18:43 localhost vdr: [2714] device 1 TS buffer thread started (pid=1799, tid=2714, prio=high)
  2023. Oct 27 20:18:43 localhost epgd: Checking tvm id 137
  2024. Oct 27 20:18:44 localhost epgd: Checking tvm id 14
  2025. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Die_glorreichen_Sieben/2019-09-16.01.48.1-0.rec/marks
  2026. Oct 27 20:18:44 localhost vdr: audio/alsa: using device 'default'
  2027. Oct 27 20:18:44 localhost vdr: audio/alsa: start delay 600ms
  2028. Oct 27 20:18:44 localhost epgd: Checking tvm id 16
  2029. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Pirates_of_the_Caribbean_4_–_Fremde_Gezeiten/2019-09-15.22.24.1-0.rec/marks
  2030. Oct 27 20:18:44 localhost epgd: Checking tvm id 168
  2031. Oct 27 20:18:44 localhost epgd: Checking tvm id 17
  2032. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Baumschlager/2019-06-01.01.01.1-0.rec/marks
  2033. Oct 27 20:18:44 localhost epgd: Checking tvm id 2
  2034. Oct 27 20:18:44 localhost epgd: Checking tvm id 269
  2035. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Lone_Ranger/2019-03-24.02.44.1-0.rec/marks
  2036. Oct 27 20:18:44 localhost epgd: Checking tvm id 294
  2037. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/scobel/scobel/2019-01-17.20.58.6-0.rec/marks
  2038. Oct 27 20:18:44 localhost epgd: Checking tvm id 3
  2039. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Gesund_durch_Fasten/Gesund_durch_Fasten/2019-01-17.20.13.6-0.rec/marks
  2040. Oct 27 20:18:44 localhost epgd: Checking tvm id 30
  2041. Oct 27 20:18:44 localhost epgd: Checking tvm id 301
  2042. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Zoomania/2018-12-26.18.08.1-0.rec/marks
  2043. Oct 27 20:18:44 localhost epgd: Checking tvm id 31
  2044. Oct 27 20:18:45 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2045. Oct 27 20:18:45 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2046. Oct 27 20:18:45 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2047. Oct 27 20:18:45 localhost vdr: [1799] switching to channel 16 S19.2E-1-1091-28810 (RTL2 Austria)
  2048. Oct 27 20:18:45 localhost vdr: [2713] osdteletext-receiver thread ended (pid=1799, tid=2713)
  2049. Oct 27 20:18:45 localhost vdr: [1799] buffer stats: 0 (0%) used
  2050. Oct 27 20:18:45 localhost epgd: Checking tvm id 314
  2051. Oct 27 20:18:45 localhost vdr: [2714] device 1 TS buffer thread ended (pid=1799, tid=2714)
  2052. Oct 27 20:18:45 localhost vdr: [2712] buffer stats: 47940 (0%) used
  2053. Oct 27 20:18:45 localhost vdr: [2712] device 1 receiver thread ended (pid=1799, tid=2712)
  2054. Oct 27 20:18:45 localhost vdr: [2720] device 1 receiver thread started (pid=1799, tid=2720, prio=high)
  2055. Oct 27 20:18:45 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1091-28810
  2056. Oct 27 20:18:45 localhost vdr: [2722] device 1 TS buffer thread started (pid=1799, tid=2722, prio=high)
  2057. Oct 27 20:18:45 localhost vdr: [2721] osdteletext-receiver thread started (pid=1799, tid=2721, prio=high)
  2058. Oct 27 20:18:45 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2059. Oct 27 20:18:45 localhost epgd: Checking tvm id 316
  2060. Oct 27 20:18:45 localhost vdr: audio/alsa: using device 'default'
  2061. Oct 27 20:18:45 localhost vdr: audio/alsa: start delay 600ms
  2062. Oct 27 20:18:45 localhost epgd: Checking tvm id 318
  2063. Oct 27 20:18:45 localhost epgd: Checking tvm id 38
  2064. Oct 27 20:18:45 localhost epgd: Checking tvm id 39
  2065. Oct 27 20:18:45 localhost epgd: Checking tvm id 4
  2066. Oct 27 20:18:45 localhost epgd: Checking tvm id 41
  2067. Oct 27 20:18:45 localhost epgd: Checking tvm id 427
  2068. Oct 27 20:18:45 localhost epgd: Checking tvm id 43
  2069. Oct 27 20:18:45 localhost epgd: Checking tvm id 430
  2070. Oct 27 20:18:45 localhost epgd: Checking tvm id 436
  2071. Oct 27 20:18:45 localhost epgd: Checking tvm id 437
  2072. Oct 27 20:18:45 localhost epgd: Checking tvm id 445
  2073. Oct 27 20:18:46 localhost epgd: Checking tvm id 447
  2074. Oct 27 20:18:46 localhost epgd: Checking tvm id 451
  2075. Oct 27 20:18:46 localhost vdr: video: decoder buffer empty, duping frame (639/8) 2 v-buf
  2076. Oct 27 20:18:46 localhost vdr: video: slow down video, duping frame
  2077. Oct 27 20:18:46 localhost vdr: video: 13:54:02.842 +106 520 0/\ms 17+7+4 v-buf
  2078. Oct 27 20:18:46 localhost vdr: video/vdpau: synced after 56 frames
  2079. Oct 27 20:18:46 localhost epgd: Checking tvm id 459
  2080. Oct 27 20:18:47 localhost epgd: Checking tvm id 46
  2081. Oct 27 20:18:47 localhost epgd: Checking tvm id 47
  2082. Oct 27 20:18:47 localhost epgd: Checking tvm id 48
  2083. Oct 27 20:18:47 localhost epgd: Checking tvm id 5
  2084. Oct 27 20:18:47 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2085. Oct 27 20:18:47 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2086. Oct 27 20:18:47 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2087. Oct 27 20:18:47 localhost vdr: [1799] switching to channel 15 S19.2E-1-1082-20004 (Kabel 1 Austria)
  2088. Oct 27 20:18:47 localhost vdr: [2721] osdteletext-receiver thread ended (pid=1799, tid=2721)
  2089. Oct 27 20:18:47 localhost vdr: [1799] buffer stats: 0 (0%) used
  2090. Oct 27 20:18:47 localhost epgd: Checking tvm id 52
  2091. Oct 27 20:18:47 localhost vdr: [2722] device 1 TS buffer thread ended (pid=1799, tid=2722)
  2092. Oct 27 20:18:47 localhost vdr: [2720] buffer stats: 30832 (0%) used
  2093. Oct 27 20:18:47 localhost vdr: [2720] device 1 receiver thread ended (pid=1799, tid=2720)
  2094. Oct 27 20:18:47 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1082-20004
  2095. Oct 27 20:18:47 localhost vdr: [2730] osdteletext-receiver thread started (pid=1799, tid=2730, prio=high)
  2096. Oct 27 20:18:47 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2097. Oct 27 20:18:47 localhost vdr: [2729] device 1 receiver thread started (pid=1799, tid=2729, prio=high)
  2098. Oct 27 20:18:47 localhost vdr: [2731] device 1 TS buffer thread started (pid=1799, tid=2731, prio=high)
  2099. Oct 27 20:18:47 localhost epgd: Checking tvm id 55
  2100. Oct 27 20:18:48 localhost epgd: Checking tvm id 57
  2101. Oct 27 20:18:48 localhost epgd: Checking tvm id 6
  2102. Oct 27 20:18:48 localhost vdr: [softhddev] invalid PES video packet
  2103. Oct 27 20:18:48 localhost vdr: [softhddev] 2 invalid PES video packet(s)
  2104. Oct 27 20:18:48 localhost vdr: audio/alsa: using device 'default'
  2105. Oct 27 20:18:48 localhost vdr: audio/alsa: start delay 600ms
  2106. Oct 27 20:18:48 localhost vdr: video: slow down video, duping frame
  2107. Oct 27 20:18:48 localhost vdr: video: decoder buffer empty, duping frame (644/86) 0 v-buf
  2108. Oct 27 20:18:48 localhost vdr: video: --:--:--.--- +0 0 0/\ms 0+5+4 v-buf
  2109. Oct 27 20:18:48 localhost epgd: Checking tvm id 60
  2110. Oct 27 20:18:48 localhost epgd: Checking tvm id 69
  2111. Oct 27 20:18:48 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2112. Oct 27 20:18:48 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2113. Oct 27 20:18:48 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2114. Oct 27 20:18:48 localhost vdr: [1799] switching to channel 14 S19.2E-1-1082-20002 (ProSieben Austria)
  2115. Oct 27 20:18:48 localhost vdr: [2730] osdteletext-receiver thread ended (pid=1799, tid=2730)
  2116. Oct 27 20:18:48 localhost vdr: [1799] buffer stats: 0 (0%) used
  2117. Oct 27 20:18:48 localhost epgd: Checking tvm id 7
  2118. Oct 27 20:18:48 localhost epgd: Checking tvm id 76
  2119. Oct 27 20:18:48 localhost vdr: [2731] device 1 TS buffer thread ended (pid=1799, tid=2731)
  2120. Oct 27 20:18:48 localhost vdr: [2729] buffer stats: 90428 (1%) used
  2121. Oct 27 20:18:48 localhost vdr: [2729] device 1 receiver thread ended (pid=1799, tid=2729)
  2122. Oct 27 20:18:48 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1082-20002
  2123. Oct 27 20:18:48 localhost vdr: [2736] osdteletext-receiver thread started (pid=1799, tid=2736, prio=high)
  2124. Oct 27 20:18:48 localhost vdr: [2735] device 1 receiver thread started (pid=1799, tid=2735, prio=high)
  2125. Oct 27 20:18:48 localhost vdr: [2737] device 1 TS buffer thread started (pid=1799, tid=2737, prio=high)
  2126. Oct 27 20:18:48 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2127. Oct 27 20:18:48 localhost epgd: Checking tvm id 8
  2128. Oct 27 20:18:48 localhost epgd: Checking tvm id 9
  2129. Oct 27 20:18:48 localhost vdr: audio/alsa: using device 'default'
  2130. Oct 27 20:18:48 localhost vdr: audio/alsa: start delay 600ms
  2131. Oct 27 20:18:48 localhost epgd: Updating 'tvsp' day today+0 now
  2132. Oct 27 20:18:49 localhost epgd: Downloaded '2NEO' for 2019-10-27 not changed, skipping.
  2133. Oct 27 20:18:49 localhost epgd: Downloaded '3SAT' for 2019-10-27 with (93373) Bytes, changed since last load.
  2134. Oct 27 20:18:49 localhost epgd: Downloaded 'ALPHA' for 2019-10-27 not changed, skipping.
  2135. Oct 27 20:18:49 localhost vdr: audio/alsa: using device 'default'
  2136. Oct 27 20:18:49 localhost vdr: audio/alsa: start delay 600ms
  2137. Oct 27 20:18:49 localhost epgd: Downloaded 'ANIXE' for 2019-10-27 not changed, skipping.
  2138. Oct 27 20:18:49 localhost epgd: Downloaded 'ARD' for 2019-10-27 with (77880) Bytes, changed since last load.
  2139. Oct 27 20:18:49 localhost epgd: Downloaded 'ARTE' for 2019-10-27 with (95330) Bytes, changed since last load.
  2140. Oct 27 20:18:50 localhost vdr: video: decoder buffer empty, duping frame (687/8) 3 v-buf
  2141. Oct 27 20:18:50 localhost vdr: video: slow down video, duping frame
  2142. Oct 27 20:18:50 localhost vdr: video: 24:13:19.359 +112 614 0/\ms 27+7+4 v-buf
  2143. Oct 27 20:18:50 localhost vdr: video/vdpau: synced after 66 frames
  2144. Oct 27 20:18:50 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2145. Oct 27 20:18:50 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2146. Oct 27 20:18:50 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2147. Oct 27 20:18:50 localhost vdr: [1799] switching to channel 13 S19.2E-1-1091-28800 (RTL Austria)
  2148. Oct 27 20:18:50 localhost vdr: [2736] osdteletext-receiver thread ended (pid=1799, tid=2736)
  2149. Oct 27 20:18:50 localhost vdr: [1799] buffer stats: 0 (0%) used
  2150. Oct 27 20:18:51 localhost vdr: [2737] device 1 TS buffer thread ended (pid=1799, tid=2737)
  2151. Oct 27 20:18:51 localhost vdr: [2735] buffer stats: 29140 (0%) used
  2152. Oct 27 20:18:51 localhost vdr: [2735] device 1 receiver thread ended (pid=1799, tid=2735)
  2153. Oct 27 20:18:51 localhost vdr: [2747] device 1 receiver thread started (pid=1799, tid=2747, prio=high)
  2154. Oct 27 20:18:51 localhost vdr: [2748] device 1 TS buffer thread started (pid=1799, tid=2748, prio=high)
  2155. Oct 27 20:18:51 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1091-28800
  2156. Oct 27 20:18:51 localhost vdr: [2749] osdteletext-receiver thread started (pid=1799, tid=2749, prio=high)
  2157. Oct 27 20:18:51 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2158. Oct 27 20:18:51 localhost epgd: Downloaded 'ATV' for 2019-10-27 with (34301) Bytes, changed since last load.
  2159. Oct 27 20:18:51 localhost vdr: audio/alsa: using device 'default'
  2160. Oct 27 20:18:51 localhost vdr: audio/alsa: start delay 600ms
  2161. Oct 27 20:18:51 localhost vdr: audio/alsa: using device 'default'
  2162. Oct 27 20:18:51 localhost vdr: audio/alsa: start delay 600ms
  2163. Oct 27 20:18:52 localhost epgd: Downloaded 'ATV2' for 2019-10-27 not changed, skipping.
  2164. Oct 27 20:18:52 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2165. Oct 27 20:18:52 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2166. Oct 27 20:18:52 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2167. Oct 27 20:18:52 localhost vdr: [1799] switching to channel 12 S19.2E-1-1082-20005 (SAT.1 A)
  2168. Oct 27 20:18:52 localhost vdr: [2749] osdteletext-receiver thread ended (pid=1799, tid=2749)
  2169. Oct 27 20:18:52 localhost vdr: [1799] buffer stats: 0 (0%) used
  2170. Oct 27 20:18:52 localhost vdr: [2748] device 1 TS buffer thread ended (pid=1799, tid=2748)
  2171. Oct 27 20:18:52 localhost vdr: [2747] buffer stats: 93624 (1%) used
  2172. Oct 27 20:18:52 localhost vdr: [2747] device 1 receiver thread ended (pid=1799, tid=2747)
  2173. Oct 27 20:18:52 localhost vdr: [2755] device 1 receiver thread started (pid=1799, tid=2755, prio=high)
  2174. Oct 27 20:18:52 localhost vdr: [2756] device 1 TS buffer thread started (pid=1799, tid=2756, prio=high)
  2175. Oct 27 20:18:52 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1082-20005
  2176. Oct 27 20:18:52 localhost vdr: [2757] osdteletext-receiver thread started (pid=1799, tid=2757, prio=high)
  2177. Oct 27 20:18:52 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2178. Oct 27 20:18:52 localhost vdr: video: slow down video, duping frame
  2179. Oct 27 20:18:52 localhost vdr: video: decoder buffer empty, duping frame (692/18) 0 v-buf
  2180. Oct 27 20:18:52 localhost vdr: video: --:--:--.--- +0 0 0/\ms 0+5+4 v-buf
  2181. Oct 27 20:18:52 localhost epgd: Downloaded 'BBC' for 2019-10-27 not changed, skipping.
  2182. Oct 27 20:18:52 localhost vdr: audio/alsa: using device 'default'
  2183. Oct 27 20:18:52 localhost vdr: audio/alsa: start delay 600ms
  2184. Oct 27 20:18:53 localhost epgd: Downloaded 'BR-S' for 2019-10-27 with (75262) Bytes, changed since last load.
  2185. Oct 27 20:18:53 localhost vdr: video: decoder buffer empty, duping frame (732/18) 4 v-buf
  2186. Oct 27 20:18:53 localhost vdr: video: slow down video, duping frame
  2187. Oct 27 20:18:53 localhost vdr: video: 23:34:53.563 +119 615 0/\ms 12+7+4 v-buf
  2188. Oct 27 20:18:54 localhost vdr: video/vdpau: synced after 47 frames
  2189. Oct 27 20:18:54 localhost epgd: Downloaded 'CC' for 2019-10-27 with (97221) Bytes, changed since last load.
  2190. Oct 27 20:18:55 localhost epgd: Downloaded 'CNBC' for 2019-10-27 not changed, skipping.
  2191. Oct 27 20:18:55 localhost epgd: Downloaded 'DISNE' for 2019-10-27 with (71822) Bytes, changed since last load.
  2192. Oct 27 20:18:56 localhost epgd: Downloaded 'DMAX' for 2019-10-27 with (31742) Bytes, changed since last load.
  2193. Oct 27 20:18:57 localhost vdr: [2421] animator thread thread ended (pid=1799, tid=2421)
  2194. Oct 27 20:18:57 localhost epgd: Downloaded 'EURON' for 2019-10-27 not changed, skipping.
  2195. Oct 27 20:18:58 localhost epgd: Downloaded 'FES' for 2019-10-27 with (85942) Bytes, changed since last load.
  2196. Oct 27 20:18:59 localhost epgd: Downloaded 'HR' for 2019-10-27 with (66475) Bytes, changed since last load.
  2197. Oct 27 20:18:59 localhost epgd: Downloaded 'K1' for 2019-10-27 not changed, skipping.
  2198. Oct 27 20:19:00 localhost epgd: Downloaded 'K1DOKU' for 2019-10-27 not changed, skipping.
  2199. Oct 27 20:19:00 localhost epgd: Downloaded 'KIKA' for 2019-10-27 not changed, skipping.
  2200. Oct 27 20:19:00 localhost epgd: Downloaded 'MDR' for 2019-10-27 not changed, skipping.
  2201. Oct 27 20:19:01 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-27]
  2202. Oct 27 20:19:01 localhost epgd: Downloaded 'N24' for 2019-10-27 failed, code: 0.
  2203. Oct 27 20:19:01 localhost epgd: Downloaded 'N24DOKU' for 2019-10-27 not changed, skipping.
  2204. Oct 27 20:19:01 localhost epgd: Downloaded 'NDR-HH' for 2019-10-27 not changed, skipping.
  2205. Oct 27 20:19:01 localhost epgd: Downloaded 'NICK' for 2019-10-27 with (54122) Bytes, changed since last load.
  2206. Oct 27 20:19:02 localhost epgd: Downloaded 'NTV' for 2019-10-27 not changed, skipping.
  2207. Oct 27 20:19:02 localhost epgd: Downloaded 'OE24TV' for 2019-10-27 not changed, skipping.
  2208. Oct 27 20:19:02 localhost epgd: Downloaded 'ORF1' for 2019-10-27 with (63821) Bytes, changed since last load.
  2209. Oct 27 20:19:03 localhost epgd: Downloaded 'ORF2' for 2019-10-27 with (58323) Bytes, changed since last load.
  2210. Oct 27 20:19:05 localhost epgd: Downloaded 'ORF3' for 2019-10-27 not changed, skipping.
  2211. Oct 27 20:19:05 localhost epgd: Downloaded 'ORFSP' for 2019-10-27 not changed, skipping.
  2212. Oct 27 20:19:05 localhost epgd: Downloaded 'PHOEN' for 2019-10-27 not changed, skipping.
  2213. Oct 27 20:19:05 localhost epgd: Downloaded 'PRO7' for 2019-10-27 with (39032) Bytes, changed since last load.
  2214. Oct 27 20:19:06 localhost epgd: Downloaded 'PRO7M' for 2019-10-27 not changed, skipping.
  2215. Oct 27 20:19:07 localhost epgd: Downloaded 'PULS4' for 2019-10-27 with (47323) Bytes, changed since last load.
  2216. Oct 27 20:19:07 localhost epgd: Downloaded 'RB-TV' for 2019-10-27 not changed, skipping.
  2217. Oct 27 20:19:08 localhost systemd[1]: Starting Stop ureadahead data collection...
  2218. Oct 27 20:19:08 localhost systemd[1]: Started Stop ureadahead data collection.
  2219. Oct 27 20:19:08 localhost epgd: Downloaded 'RBB' for 2019-10-27 not changed, skipping.
  2220. Oct 27 20:19:09 localhost epgd: Downloaded 'RIC' for 2019-10-27 not changed, skipping.
  2221. Oct 27 20:19:10 localhost epgd: Downloaded 'RTL' for 2019-10-27 not changed, skipping.
  2222. Oct 27 20:19:10 localhost epgd: Downloaded 'RTL-N' for 2019-10-27 with (49245) Bytes, changed since last load.
  2223. Oct 27 20:19:11 localhost epgd: Downloaded 'RTL2' for 2019-10-27 with (43515) Bytes, changed since last load.
  2224. Oct 27 20:19:12 localhost epgd: Downloaded 'SAT1' for 2019-10-27 not changed, skipping.
  2225. Oct 27 20:19:12 localhost epgd: Downloaded 'SAT1G' for 2019-10-27 with (66298) Bytes, changed since last load.
  2226. Oct 27 20:19:13 localhost epgd: Downloaded 'SERVU' for 2019-10-27 not changed, skipping.
  2227. Oct 27 20:19:14 localhost vdr: epg2vdr: Trying to re-connect to database!
  2228. Oct 27 20:19:14 localhost vdr: epg2vdr: Info: Last update was at '26.10.19 21:33:14'
  2229. Oct 27 20:19:14 localhost vdr: epg2vdr: Handler: Start reading external ids from db
  2230. Oct 27 20:19:14 localhost vdr: epg2vdr: Handler: Finished reading external id's from db, got 180 id's
  2231. Oct 27 20:19:14 localhost vdr: epg2vdr: Connection established successfull!
  2232. Oct 27 20:19:14 localhost vdr: epg2vdr: Cleanup deleted recordings at database (forced)
  2233. Oct 27 20:19:14 localhost vdr: epg2vdr: Info: Marked 0 recordings as deleted
  2234. Oct 27 20:19:14 localhost vdr: epg2vdr: Updating recording list table
  2235. Oct 27 20:19:14 localhost epgd: Downloaded 'SIXX' for 2019-10-27 with (42294) Bytes, changed since last load.
  2236. Oct 27 20:19:15 localhost vdr: epg2vdr: Info: Found 256 recordings; 0 inserted; 77 updated and 53 directories
  2237. Oct 27 20:19:15 localhost vdr: epg2vdr: Detected epgd state 'busy (events)' (3)
  2238. Oct 27 20:19:15 localhost epgd: Downloaded 'SR' for 2019-10-27 with (88283) Bytes, changed since last load.
  2239. Oct 27 20:19:16 localhost epgd: Downloaded 'SUPER' for 2019-10-27 with (35687) Bytes, changed since last load.
  2240. Oct 27 20:19:16 localhost epgd: Downloaded 'SWRBW' for 2019-10-27 with (87853) Bytes, changed since last load.
  2241. Oct 27 20:19:18 localhost epgd: Downloaded 'TAG24' for 2019-10-27 not changed, skipping.
  2242. Oct 27 20:19:19 localhost epgd: Downloaded 'TELE5' for 2019-10-27 with (47433) Bytes, changed since last load.
  2243. Oct 27 20:19:20 localhost epgd: Downloaded 'TLC' for 2019-10-27 not changed, skipping.
  2244. Oct 27 20:19:21 localhost epgd: Downloaded 'TOGGO' for 2019-10-27 not changed, skipping.
  2245. Oct 27 20:19:21 localhost epgd: Downloaded 'VOX' for 2019-10-27 with (60528) Bytes, changed since last load.
  2246. Oct 27 20:19:23 localhost epgd: Downloaded 'WDR' for 2019-10-27 with (64038) Bytes, changed since last load.
  2247. Oct 27 20:19:24 localhost vdr: video: slow down video, duping frame
  2248. Oct 27 20:19:24 localhost vdr: video: speed up video, droping frame
  2249. Oct 27 20:19:24 localhost vdr: video: 23:35:23.963 -25 630 0/\ms 14+5+4 v-buf
  2250. Oct 27 20:19:25 localhost epgd: Downloaded 'WDWTV' for 2019-10-27 not changed, skipping.
  2251. Oct 27 20:19:25 localhost epgd: Downloaded 'ZDF' for 2019-10-27 with (116261) Bytes, changed since last load.
  2252. Oct 27 20:19:26 localhost epgd: Downloaded 'ZINFO' for 2019-10-27 not changed, skipping.
  2253. Oct 27 20:19:26 localhost epgd: Downloading images...
  2254. Oct 27 20:19:27 localhost epgd: Downloaded 1 images
  2255. Oct 27 20:19:27 localhost epgd: Updating 'tvm' day today+1 now
  2256. Oct 27 20:19:27 localhost epgd: Skipping day 1 for TVM plugin, since all days ar performed on day 0
  2257. Oct 27 20:19:27 localhost epgd: Updating 'tvsp' day today+1 now
  2258. Oct 27 20:19:27 localhost epgd: Downloaded '2NEO' for 2019-10-28 with (90983) Bytes, changed since last load.
  2259. Oct 27 20:19:27 localhost epgd: Downloaded '3SAT' for 2019-10-28 with (83614) Bytes, changed since last load.
  2260. Oct 27 20:19:28 localhost epgd: Downloaded 'ALPHA' for 2019-10-28 not changed, skipping.
  2261. Oct 27 20:19:28 localhost epgd: Downloaded 'ANIXE' for 2019-10-28 not changed, skipping.
  2262. Oct 27 20:19:28 localhost epgd: Downloaded 'ARD' for 2019-10-28 with (72632) Bytes, changed since last load.
  2263. Oct 27 20:19:29 localhost epgd: Downloaded 'ARTE' for 2019-10-28 with (81562) Bytes, changed since last load.
  2264. Oct 27 20:19:30 localhost epgd: Downloaded 'ATV' for 2019-10-28 with (48412) Bytes, changed since last load.
  2265. Oct 27 20:19:31 localhost epgd: Downloaded 'ATV2' for 2019-10-28 not changed, skipping.
  2266. Oct 27 20:19:31 localhost epgd: Downloaded 'BBC' for 2019-10-28 not changed, skipping.
  2267. Oct 27 20:19:31 localhost epgd: Downloaded 'BR-S' for 2019-10-28 with (79825) Bytes, changed since last load.
  2268. Oct 27 20:19:32 localhost epgd: Downloaded 'CC' for 2019-10-28 with (101887) Bytes, changed since last load.
  2269. Oct 27 20:19:32 localhost epgd: Downloaded 'CNBC' for 2019-10-28 not changed, skipping.
  2270. Oct 27 20:19:33 localhost epgd: Downloaded 'DISNE' for 2019-10-28 with (74069) Bytes, changed since last load.
  2271. Oct 27 20:19:33 localhost epgd: Downloaded 'DMAX' for 2019-10-28 with (34919) Bytes, changed since last load.
  2272. Oct 27 20:19:34 localhost epgd: Downloaded 'EURON' for 2019-10-28 not changed, skipping.
  2273. Oct 27 20:19:34 localhost epgd: Downloaded 'FES' for 2019-10-28 with (91635) Bytes, changed since last load.
  2274. Oct 27 20:19:34 localhost epgd: Downloaded 'HR' for 2019-10-28 with (70866) Bytes, changed since last load.
  2275. Oct 27 20:19:35 localhost epgd: Downloaded 'K1' for 2019-10-28 with (56201) Bytes, changed since last load.
  2276. Oct 27 20:19:35 localhost epgd: Downloaded 'K1DOKU' for 2019-10-28 not changed, skipping.
  2277. Oct 27 20:19:36 localhost epgd: Downloaded 'KIKA' for 2019-10-28 not changed, skipping.
  2278. Oct 27 20:19:36 localhost epgd: Downloaded 'MDR' for 2019-10-28 with (69039) Bytes, changed since last load.
  2279. Oct 27 20:19:37 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-28]
  2280. Oct 27 20:19:37 localhost epgd: Downloaded 'N24' for 2019-10-28 failed, code: 0.
  2281. Oct 27 20:19:37 localhost epgd: Downloaded 'N24DOKU' for 2019-10-28 not changed, skipping.
  2282. Oct 27 20:19:37 localhost epgd: Downloaded 'NDR-HH' for 2019-10-28 with (82337) Bytes, changed since last load.
  2283. Oct 27 20:19:38 localhost epgd: Downloaded 'NICK' for 2019-10-28 with (65384) Bytes, changed since last load.
  2284. Oct 27 20:19:39 localhost epgd: Downloaded 'NTV' for 2019-10-28 not changed, skipping.
  2285. Oct 27 20:19:39 localhost epgd: Downloaded 'OE24TV' for 2019-10-28 not changed, skipping.
  2286. Oct 27 20:19:40 localhost epgd: Downloaded 'ORF1' for 2019-10-28 with (107161) Bytes, changed since last load.
  2287. Oct 27 20:19:40 localhost epgd: Downloaded 'ORF2' for 2019-10-28 with (54679) Bytes, changed since last load.
  2288. Oct 27 20:19:42 localhost epgd: Downloaded 'ORF3' for 2019-10-28 not changed, skipping.
  2289. Oct 27 20:19:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2290. Oct 27 20:19:42 localhost epgd: Downloaded 'ORFSP' for 2019-10-28 not changed, skipping.
  2291. Oct 27 20:19:42 localhost epgd: Downloaded 'PHOEN' for 2019-10-28 not changed, skipping.
  2292. Oct 27 20:19:43 localhost epgd: Downloaded 'PRO7' for 2019-10-28 with (106261) Bytes, changed since last load.
  2293. Oct 27 20:19:44 localhost epgd: Downloaded 'PRO7M' for 2019-10-28 with (58358) Bytes, changed since last load.
  2294. Oct 27 20:19:44 localhost epgd: Downloaded 'PULS4' for 2019-10-28 not changed, skipping.
  2295. Oct 27 20:19:44 localhost epgd: Downloaded 'RB-TV' for 2019-10-28 with (85215) Bytes, changed since last load.
  2296. Oct 27 20:19:45 localhost epgd: Downloaded 'RBB' for 2019-10-28 with (73069) Bytes, changed since last load.
  2297. Oct 27 20:19:45 localhost epgd: Downloaded 'RIC' for 2019-10-28 not changed, skipping.
  2298. Oct 27 20:19:45 localhost epgd: Downloaded 'RTL' for 2019-10-28 not changed, skipping.
  2299. Oct 27 20:19:46 localhost epgd: Downloaded 'RTL-N' for 2019-10-28 with (48271) Bytes, changed since last load.
  2300. Oct 27 20:19:46 localhost epgd: Downloaded 'RTL2' for 2019-10-28 not changed, skipping.
  2301. Oct 27 20:19:46 localhost epgd: Downloaded 'SAT1' for 2019-10-28 not changed, skipping.
  2302. Oct 27 20:19:46 localhost epgd: Downloaded 'SAT1G' for 2019-10-28 with (54441) Bytes, changed since last load.
  2303. Oct 27 20:19:47 localhost epgd: Downloaded 'SERVU' for 2019-10-28 not changed, skipping.
  2304. Oct 27 20:19:47 localhost epgd: Downloaded 'SIXX' for 2019-10-28 with (60156) Bytes, changed since last load.
  2305. Oct 27 20:19:47 localhost epgd: Downloaded 'SR' for 2019-10-28 not changed, skipping.
  2306. Oct 27 20:19:47 localhost epgd: Downloaded 'SUPER' for 2019-10-28 not changed, skipping.
  2307. Oct 27 20:19:48 localhost epgd: Downloaded 'SWRBW' for 2019-10-28 not changed, skipping.
  2308. Oct 27 20:19:48 localhost epgd: Downloaded 'TAG24' for 2019-10-28 not changed, skipping.
  2309. Oct 27 20:19:48 localhost epgd: Downloaded 'TELE5' for 2019-10-28 with (56873) Bytes, changed since last load.
  2310. Oct 27 20:19:48 localhost epgd: Downloaded 'TLC' for 2019-10-28 not changed, skipping.
  2311. Oct 27 20:19:49 localhost epgd: Downloaded 'TOGGO' for 2019-10-28 not changed, skipping.
  2312. Oct 27 20:19:49 localhost epgd: Downloaded 'VOX' for 2019-10-28 with (52555) Bytes, changed since last load.
  2313. Oct 27 20:19:49 localhost epgd: Downloaded 'WDR' for 2019-10-28 with (74911) Bytes, changed since last load.
  2314. Oct 27 20:19:51 localhost epgd: Downloaded 'WDWTV' for 2019-10-28 not changed, skipping.
  2315. Oct 27 20:19:51 localhost epgd: Downloaded 'ZDF' for 2019-10-28 with (68953) Bytes, changed since last load.
  2316. Oct 27 20:19:52 localhost epgd: Downloaded 'ZINFO' for 2019-10-28 not changed, skipping.
  2317. Oct 27 20:19:52 localhost epgd: Downloading images...
  2318. Oct 27 20:19:53 localhost vdr: video: 23:35:52.723 +12 580 0/\ms 12+6+4 v-buf
  2319. Oct 27 20:19:53 localhost epgd: Downloaded 2 images
  2320. Oct 27 20:19:53 localhost epgd: Updating 'tvm' day today+2 now
  2321. Oct 27 20:19:53 localhost epgd: Skipping day 2 for TVM plugin, since all days ar performed on day 0
  2322. Oct 27 20:19:53 localhost epgd: Updating 'tvsp' day today+2 now
  2323. Oct 27 20:19:54 localhost epgd: Downloaded '2NEO' for 2019-10-29 with (106390) Bytes, changed since last load.
  2324. Oct 27 20:19:54 localhost epgd: Downloaded '3SAT' for 2019-10-29 not changed, skipping.
  2325. Oct 27 20:19:55 localhost epgd: Downloaded 'ALPHA' for 2019-10-29 not changed, skipping.
  2326. Oct 27 20:19:55 localhost vdr: epg2vdr: Handler: Init handler instance for thread 1932
  2327. Oct 27 20:19:55 localhost epgd: Downloaded 'ANIXE' for 2019-10-29 with (45551) Bytes, changed since last load.
  2328. Oct 27 20:19:55 localhost epgd: Downloaded 'ARD' for 2019-10-29 with (75749) Bytes, changed since last load.
  2329. Oct 27 20:19:56 localhost epgd: Downloaded 'ARTE' for 2019-10-29 with (87574) Bytes, changed since last load.
  2330. Oct 27 20:19:57 localhost epgd: Downloaded 'ATV' for 2019-10-29 not changed, skipping.
  2331. Oct 27 20:19:57 localhost epgd: Downloaded 'ATV2' for 2019-10-29 with (42612) Bytes, changed since last load.
  2332. Oct 27 20:19:57 localhost epgd: Downloaded 'BBC' for 2019-10-29 not changed, skipping.
  2333. Oct 27 20:19:58 localhost epgd: Downloaded 'BR-S' for 2019-10-29 with (73589) Bytes, changed since last load.
  2334. Oct 27 20:19:58 localhost epgd: Downloaded 'CC' for 2019-10-29 with (102867) Bytes, changed since last load.
  2335. Oct 27 20:19:58 localhost epgd: Downloaded 'CNBC' for 2019-10-29 not changed, skipping.
  2336. Oct 27 20:19:59 localhost epgd: Downloaded 'DISNE' for 2019-10-29 with (79460) Bytes, changed since last load.
  2337. Oct 27 20:19:59 localhost epgd: Downloaded 'DMAX' for 2019-10-29 with (38741) Bytes, changed since last load.
  2338. Oct 27 20:20:00 localhost epgd: Downloaded 'EURON' for 2019-10-29 not changed, skipping.
  2339. Oct 27 20:20:00 localhost epgd: Downloaded 'FES' for 2019-10-29 with (96502) Bytes, changed since last load.
  2340. Oct 27 20:20:01 localhost epgd: Downloaded 'HR' for 2019-10-29 with (80006) Bytes, changed since last load.
  2341. Oct 27 20:20:02 localhost epgd: Downloaded 'K1' for 2019-10-29 with (58200) Bytes, changed since last load.
  2342. Oct 27 20:20:02 localhost epgd: Downloaded 'K1DOKU' for 2019-10-29 not changed, skipping.
  2343. Oct 27 20:20:02 localhost epgd: Downloaded 'KIKA' for 2019-10-29 not changed, skipping.
  2344. Oct 27 20:20:03 localhost epgd: Downloaded 'MDR' for 2019-10-29 with (75760) Bytes, changed since last load.
  2345. Oct 27 20:20:03 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-29]
  2346. Oct 27 20:20:03 localhost epgd: Downloaded 'N24' for 2019-10-29 failed, code: 0.
  2347. Oct 27 20:20:04 localhost epgd: Downloaded 'N24DOKU' for 2019-10-29 not changed, skipping.
  2348. Oct 27 20:20:05 localhost epgd: Downloaded 'NDR-HH' for 2019-10-29 with (73911) Bytes, changed since last load.
  2349. Oct 27 20:20:06 localhost epgd: Downloaded 'NICK' for 2019-10-29 with (63412) Bytes, changed since last load.
  2350. Oct 27 20:20:06 localhost epgd: Downloaded 'NTV' for 2019-10-29 not changed, skipping.
  2351. Oct 27 20:20:06 localhost epgd: Downloaded 'OE24TV' for 2019-10-29 not changed, skipping.
  2352. Oct 27 20:20:07 localhost epgd: Downloaded 'ORF1' for 2019-10-29 with (111616) Bytes, changed since last load.
  2353. Oct 27 20:20:07 localhost epgd: Downloaded 'ORF2' for 2019-10-29 with (54723) Bytes, changed since last load.
  2354. Oct 27 20:20:09 localhost epgd: Downloaded 'ORF3' for 2019-10-29 not changed, skipping.
  2355. Oct 27 20:20:09 localhost epgd: Downloaded 'ORFSP' for 2019-10-29 not changed, skipping.
  2356. Oct 27 20:20:09 localhost epgd: Downloaded 'PHOEN' for 2019-10-29 not changed, skipping.
  2357. Oct 27 20:20:09 localhost epgd: Downloaded 'PRO7' for 2019-10-29 with (101107) Bytes, changed since last load.
  2358. Oct 27 20:20:10 localhost epgd: Downloaded 'PRO7M' for 2019-10-29 with (49920) Bytes, changed since last load.
  2359. Oct 27 20:20:10 localhost epgd: Downloaded 'PULS4' for 2019-10-29 not changed, skipping.
  2360. Oct 27 20:20:10 localhost epgd: Downloaded 'RB-TV' for 2019-10-29 with (76715) Bytes, changed since last load.
  2361. Oct 27 20:20:11 localhost epgd: Downloaded 'RBB' for 2019-10-29 with (70361) Bytes, changed since last load.
  2362. Oct 27 20:20:12 localhost epgd: Downloaded 'RIC' for 2019-10-29 not changed, skipping.
  2363. Oct 27 20:20:12 localhost epgd: Downloaded 'RTL' for 2019-10-29 with (37621) Bytes, changed since last load.
  2364. Oct 27 20:20:13 localhost epgd: Downloaded 'RTL-N' for 2019-10-29 with (59265) Bytes, changed since last load.
  2365. Oct 27 20:20:13 localhost epgd: Downloaded 'RTL2' for 2019-10-29 not changed, skipping.
  2366. Oct 27 20:20:14 localhost epgd: Downloaded 'SAT1' for 2019-10-29 not changed, skipping.
  2367. Oct 27 20:20:14 localhost epgd: Downloaded 'SAT1G' for 2019-10-29 with (63983) Bytes, changed since last load.
  2368. Oct 27 20:20:15 localhost epgd: Downloaded 'SERVU' for 2019-10-29 with (61798) Bytes, changed since last load.
  2369. Oct 27 20:20:15 localhost vdr: epg2vdr: Update info.epg2vdr recordings
  2370. Oct 27 20:20:15 localhost vdr: epg2vdr: Updated 0 info.epg2vdr files
  2371. Oct 27 20:20:15 localhost epgd: Downloaded 'SIXX' for 2019-10-29 with (65838) Bytes, changed since last load.
  2372. Oct 27 20:20:15 localhost epgd: Downloaded 'SR' for 2019-10-29 not changed, skipping.
  2373. Oct 27 20:20:15 localhost epgd: Downloaded 'SUPER' for 2019-10-29 not changed, skipping.
  2374. Oct 27 20:20:15 localhost epgd: Downloaded 'SWRBW' for 2019-10-29 not changed, skipping.
  2375. Oct 27 20:20:16 localhost epgd: Downloaded 'TAG24' for 2019-10-29 not changed, skipping.
  2376. Oct 27 20:20:16 localhost epgd: Downloaded 'TELE5' for 2019-10-29 with (57365) Bytes, changed since last load.
  2377. Oct 27 20:20:16 localhost epgd: Downloaded 'TLC' for 2019-10-29 not changed, skipping.
  2378. Oct 27 20:20:16 localhost epgd: Downloaded 'TOGGO' for 2019-10-29 not changed, skipping.
  2379. Oct 27 20:20:17 localhost epgd: Downloaded 'VOX' for 2019-10-29 with (51367) Bytes, changed since last load.
  2380. Oct 27 20:20:17 localhost epgd: Downloaded 'WDR' for 2019-10-29 not changed, skipping.
  2381. Oct 27 20:20:18 localhost epgd: Downloaded 'WDWTV' for 2019-10-29 not changed, skipping.
  2382. Oct 27 20:20:18 localhost epgd: Downloaded 'ZDF' for 2019-10-29 with (72695) Bytes, changed since last load.
  2383. Oct 27 20:20:19 localhost epgd: Downloaded 'ZINFO' for 2019-10-29 not changed, skipping.
  2384. Oct 27 20:20:19 localhost epgd: Downloading images...
  2385. Oct 27 20:20:19 localhost epgd: Downloaded 1 images
  2386. Oct 27 20:20:19 localhost epgd: Updating 'tvm' day today+3 now
  2387. Oct 27 20:20:19 localhost epgd: Skipping day 3 for TVM plugin, since all days ar performed on day 0
  2388. Oct 27 20:20:19 localhost epgd: Updating 'tvsp' day today+3 now
  2389. Oct 27 20:20:20 localhost epgd: Downloaded '2NEO' for 2019-10-30 with (114138) Bytes, changed since last load.
  2390. Oct 27 20:20:20 localhost epgd: Downloaded '3SAT' for 2019-10-30 with (90297) Bytes, changed since last load.
  2391. Oct 27 20:20:21 localhost epgd: Downloaded 'ALPHA' for 2019-10-30 not changed, skipping.
  2392. Oct 27 20:20:21 localhost epgd: Downloaded 'ANIXE' for 2019-10-30 with (47735) Bytes, changed since last load.
  2393. Oct 27 20:20:22 localhost epgd: Downloaded 'ARD' for 2019-10-30 with (70686) Bytes, changed since last load.
  2394. Oct 27 20:20:22 localhost epgd: Downloaded 'ARTE' for 2019-10-30 with (82344) Bytes, changed since last load.
  2395. Oct 27 20:20:23 localhost epgd: Downloaded 'ATV' for 2019-10-30 not changed, skipping.
  2396. Oct 27 20:20:23 localhost epgd: Downloaded 'ATV2' for 2019-10-30 not changed, skipping.
  2397. Oct 27 20:20:24 localhost epgd: Downloaded 'BBC' for 2019-10-30 not changed, skipping.
  2398. Oct 27 20:20:25 localhost epgd: Downloaded 'BR-S' for 2019-10-30 with (83658) Bytes, changed since last load.
  2399. Oct 27 20:20:25 localhost epgd: Downloaded 'CC' for 2019-10-30 with (100718) Bytes, changed since last load.
  2400. Oct 27 20:20:26 localhost epgd: Downloaded 'CNBC' for 2019-10-30 not changed, skipping.
  2401. Oct 27 20:20:26 localhost epgd: Downloaded 'DISNE' for 2019-10-30 with (79841) Bytes, changed since last load.
  2402. Oct 27 20:20:27 localhost epgd: Downloaded 'DMAX' for 2019-10-30 with (35691) Bytes, changed since last load.
  2403. Oct 27 20:20:27 localhost epgd: Downloaded 'EURON' for 2019-10-30 not changed, skipping.
  2404. Oct 27 20:20:28 localhost epgd: Downloaded 'FES' for 2019-10-30 with (89955) Bytes, changed since last load.
  2405. Oct 27 20:20:28 localhost epgd: Downloaded 'HR' for 2019-10-30 with (81383) Bytes, changed since last load.
  2406. Oct 27 20:20:28 localhost epgd: Downloaded 'K1' for 2019-10-30 with (63298) Bytes, changed since last load.
  2407. Oct 27 20:20:29 localhost epgd: Downloaded 'K1DOKU' for 2019-10-30 not changed, skipping.
  2408. Oct 27 20:20:29 localhost epgd: Downloaded 'KIKA' for 2019-10-30 not changed, skipping.
  2409. Oct 27 20:20:30 localhost epgd: Downloaded 'MDR' for 2019-10-30 with (77792) Bytes, changed since last load.
  2410. Oct 27 20:20:30 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-30]
  2411. Oct 27 20:20:30 localhost epgd: Downloaded 'N24' for 2019-10-30 failed, code: 0.
  2412. Oct 27 20:20:31 localhost epgd: Downloaded 'N24DOKU' for 2019-10-30 not changed, skipping.
  2413. Oct 27 20:20:32 localhost epgd: Downloaded 'NDR-HH' for 2019-10-30 with (79852) Bytes, changed since last load.
  2414. Oct 27 20:20:33 localhost epgd: Downloaded 'NICK' for 2019-10-30 with (64460) Bytes, changed since last load.
  2415. Oct 27 20:20:34 localhost epgd: Downloaded 'NTV' for 2019-10-30 not changed, skipping.
  2416. Oct 27 20:20:34 localhost epgd: Downloaded 'OE24TV' for 2019-10-30 not changed, skipping.
  2417. Oct 27 20:20:34 localhost epgd: Downloaded 'ORF1' for 2019-10-30 with (94215) Bytes, changed since last load.
  2418. Oct 27 20:20:35 localhost epgd: Downloaded 'ORF2' for 2019-10-30 with (60923) Bytes, changed since last load.
  2419. Oct 27 20:20:36 localhost epgd: Downloaded 'ORF3' for 2019-10-30 not changed, skipping.
  2420. Oct 27 20:20:37 localhost epgd: Downloaded 'ORFSP' for 2019-10-30 not changed, skipping.
  2421. Oct 27 20:20:37 localhost epgd: Downloaded 'PHOEN' for 2019-10-30 not changed, skipping.
  2422. Oct 27 20:20:38 localhost epgd: Downloaded 'PRO7' for 2019-10-30 with (104497) Bytes, changed since last load.
  2423. Oct 27 20:20:39 localhost epgd: Downloaded 'PRO7M' for 2019-10-30 with (57705) Bytes, changed since last load.
  2424. Oct 27 20:20:40 localhost epgd: Downloaded 'PULS4' for 2019-10-30 not changed, skipping.
  2425. Oct 27 20:20:41 localhost epgd: Downloaded 'RB-TV' for 2019-10-30 with (82663) Bytes, changed since last load.
  2426. Oct 27 20:20:42 localhost epgd: Downloaded 'RBB' for 2019-10-30 with (68129) Bytes, changed since last load.
  2427. Oct 27 20:20:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2428. Oct 27 20:20:42 localhost epgd: Downloaded 'RIC' for 2019-10-30 not changed, skipping.
  2429. Oct 27 20:20:43 localhost epgd: Downloaded 'RTL' for 2019-10-30 with (39289) Bytes, changed since last load.
  2430. Oct 27 20:20:44 localhost epgd: Downloaded 'RTL-N' for 2019-10-30 with (60593) Bytes, changed since last load.
  2431. Oct 27 20:20:45 localhost epgd: Downloaded 'RTL2' for 2019-10-30 not changed, skipping.
  2432. Oct 27 20:20:45 localhost epgd: Downloaded 'SAT1' for 2019-10-30 not changed, skipping.
  2433. Oct 27 20:20:46 localhost epgd: Downloaded 'SAT1G' for 2019-10-30 with (76505) Bytes, changed since last load.
  2434. Oct 27 20:20:47 localhost epgd: Downloaded 'SERVU' for 2019-10-30 not changed, skipping.
  2435. Oct 27 20:20:47 localhost epgd: Downloaded 'SIXX' for 2019-10-30 with (50599) Bytes, changed since last load.
  2436. Oct 27 20:20:48 localhost epgd: Downloaded 'SR' for 2019-10-30 not changed, skipping.
  2437. Oct 27 20:20:48 localhost epgd: Downloaded 'SUPER' for 2019-10-30 not changed, skipping.
  2438. Oct 27 20:20:48 localhost epgd: Downloaded 'SWRBW' for 2019-10-30 not changed, skipping.
  2439. Oct 27 20:20:48 localhost epgd: Downloaded 'TAG24' for 2019-10-30 not changed, skipping.
  2440. Oct 27 20:20:49 localhost epgd: Downloaded 'TELE5' for 2019-10-30 with (51152) Bytes, changed since last load.
  2441. Oct 27 20:20:50 localhost epgd: Downloaded 'TLC' for 2019-10-30 not changed, skipping.
  2442. Oct 27 20:20:51 localhost epgd: Downloaded 'TOGGO' for 2019-10-30 not changed, skipping.
  2443. Oct 27 20:20:52 localhost epgd: Downloaded 'VOX' for 2019-10-30 with (59738) Bytes, changed since last load.
  2444. Oct 27 20:20:53 localhost vdr: video: 23:36:52.723 +13 581 0/\ms 11+6+4 v-buf
  2445. Oct 27 20:20:53 localhost epgd: Downloaded 'WDR' for 2019-10-30 not changed, skipping.
  2446. Oct 27 20:20:54 localhost epgd: Downloaded 'WDWTV' for 2019-10-30 not changed, skipping.
  2447. Oct 27 20:20:56 localhost epgd: Downloaded 'ZDF' for 2019-10-30 with (85625) Bytes, changed since last load.
  2448. Oct 27 20:20:57 localhost epgd: Downloaded 'ZINFO' for 2019-10-30 not changed, skipping.
  2449. Oct 27 20:20:57 localhost epgd: Downloading images...
  2450. Oct 27 20:20:57 localhost epgd: Downloaded 0 images
  2451. Oct 27 20:20:57 localhost epgd: Updating 'tvm' day today+4 now
  2452. Oct 27 20:20:57 localhost epgd: Skipping day 4 for TVM plugin, since all days ar performed on day 0
  2453. Oct 27 20:20:57 localhost epgd: Updating 'tvsp' day today+4 now
  2454. Oct 27 20:20:57 localhost epgd: Downloaded '2NEO' for 2019-10-31 with (111990) Bytes, changed since last load.
  2455. Oct 27 20:20:58 localhost epgd: Downloaded '3SAT' for 2019-10-31 not changed, skipping.
  2456. Oct 27 20:20:58 localhost epgd: Downloaded 'ALPHA' for 2019-10-31 not changed, skipping.
  2457. Oct 27 20:20:58 localhost epgd: Downloaded 'ANIXE' for 2019-10-31 not changed, skipping.
  2458. Oct 27 20:20:59 localhost epgd: Downloaded 'ARD' for 2019-10-31 with (69409) Bytes, changed since last load.
  2459. Oct 27 20:21:00 localhost epgd: Downloaded 'ARTE' for 2019-10-31 with (94117) Bytes, changed since last load.
  2460. Oct 27 20:21:00 localhost epgd: Downloaded 'ATV' for 2019-10-31 not changed, skipping.
  2461. Oct 27 20:21:00 localhost epgd: Downloaded 'ATV2' for 2019-10-31 not changed, skipping.
  2462. Oct 27 20:21:00 localhost epgd: Downloaded 'BBC' for 2019-10-31 not changed, skipping.
  2463. Oct 27 20:21:00 localhost epgd: Downloaded 'BR-S' for 2019-10-31 with (78968) Bytes, changed since last load.
  2464. Oct 27 20:21:01 localhost epgd: Downloaded 'CC' for 2019-10-31 with (103145) Bytes, changed since last load.
  2465. Oct 27 20:21:01 localhost epgd: Downloaded 'CNBC' for 2019-10-31 not changed, skipping.
  2466. Oct 27 20:21:01 localhost epgd: Downloaded 'DISNE' for 2019-10-31 with (79541) Bytes, changed since last load.
  2467. Oct 27 20:21:01 localhost epgd: Downloaded 'DMAX' for 2019-10-31 with (33113) Bytes, changed since last load.
  2468. Oct 27 20:21:02 localhost epgd: Downloaded 'EURON' for 2019-10-31 not changed, skipping.
  2469. Oct 27 20:21:02 localhost epgd: Downloaded 'FES' for 2019-10-31 with (107639) Bytes, changed since last load.
  2470. Oct 27 20:21:02 localhost epgd: Downloaded 'HR' for 2019-10-31 with (76626) Bytes, changed since last load.
  2471. Oct 27 20:21:02 localhost epgd: Downloaded 'K1' for 2019-10-31 with (46051) Bytes, changed since last load.
  2472. Oct 27 20:21:03 localhost epgd: Downloaded 'K1DOKU' for 2019-10-31 not changed, skipping.
  2473. Oct 27 20:21:03 localhost epgd: Downloaded 'KIKA' for 2019-10-31 not changed, skipping.
  2474. Oct 27 20:21:03 localhost epgd: Downloaded 'MDR' for 2019-10-31 with (76255) Bytes, changed since last load.
  2475. Oct 27 20:21:04 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-31]
  2476. Oct 27 20:21:04 localhost epgd: Downloaded 'N24' for 2019-10-31 failed, code: 0.
  2477. Oct 27 20:21:04 localhost epgd: Downloaded 'N24DOKU' for 2019-10-31 not changed, skipping.
  2478. Oct 27 20:21:05 localhost epgd: Downloaded 'NDR-HH' for 2019-10-31 with (81994) Bytes, changed since last load.
  2479. Oct 27 20:21:06 localhost epgd: Downloaded 'NICK' for 2019-10-31 with (59266) Bytes, changed since last load.
  2480. Oct 27 20:21:06 localhost epgd: Downloaded 'NTV' for 2019-10-31 not changed, skipping.
  2481. Oct 27 20:21:06 localhost epgd: Downloaded 'OE24TV' for 2019-10-31 not changed, skipping.
  2482. Oct 27 20:21:06 localhost epgd: Downloaded 'ORF1' for 2019-10-31 with (100383) Bytes, changed since last load.
  2483. Oct 27 20:21:06 localhost epgd: Downloaded 'ORF2' for 2019-10-31 with (55031) Bytes, changed since last load.
  2484. Oct 27 20:21:07 localhost epgd: Downloaded 'ORF3' for 2019-10-31 not changed, skipping.
  2485. Oct 27 20:21:08 localhost epgd: Downloaded 'ORFSP' for 2019-10-31 not changed, skipping.
  2486. Oct 27 20:21:08 localhost epgd: Downloaded 'PHOEN' for 2019-10-31 not changed, skipping.
  2487. Oct 27 20:21:08 localhost epgd: Downloaded 'PRO7' for 2019-10-31 with (85610) Bytes, changed since last load.
  2488. Oct 27 20:21:08 localhost epgd: Downloaded 'PRO7M' for 2019-10-31 with (47898) Bytes, changed since last load.
  2489. Oct 27 20:21:08 localhost epgd: Downloaded 'PULS4' for 2019-10-31 not changed, skipping.
  2490. Oct 27 20:21:08 localhost epgd: Downloaded 'RB-TV' for 2019-10-31 with (82666) Bytes, changed since last load.
  2491. Oct 27 20:21:09 localhost epgd: Downloaded 'RBB' for 2019-10-31 with (63772) Bytes, changed since last load.
  2492. Oct 27 20:21:10 localhost epgd: Downloaded 'RIC' for 2019-10-31 not changed, skipping.
  2493. Oct 27 20:21:10 localhost epgd: Downloaded 'RTL' for 2019-10-31 not changed, skipping.
  2494. Oct 27 20:21:11 localhost epgd: Downloaded 'RTL-N' for 2019-10-31 with (50506) Bytes, changed since last load.
  2495. Oct 27 20:21:12 localhost epgd: Downloaded 'RTL2' for 2019-10-31 with (36474) Bytes, changed since last load.
  2496. Oct 27 20:21:12 localhost epgd: Downloaded 'SAT1' for 2019-10-31 with (40544) Bytes, changed since last load.
  2497. Oct 27 20:21:13 localhost epgd: Downloaded 'SAT1G' for 2019-10-31 with (71563) Bytes, changed since last load.
  2498. Oct 27 20:21:13 localhost epgd: Downloaded 'SERVU' for 2019-10-31 with (53926) Bytes, changed since last load.
  2499. Oct 27 20:21:14 localhost epgd: Downloaded 'SIXX' for 2019-10-31 with (59157) Bytes, changed since last load.
  2500. Oct 27 20:21:15 localhost epgd: Downloaded 'SR' for 2019-10-31 not changed, skipping.
  2501. Oct 27 20:21:15 localhost epgd: Downloaded 'SUPER' for 2019-10-31 with (43250) Bytes, changed since last load.
  2502. Oct 27 20:21:15 localhost epgd: Downloaded 'SWRBW' for 2019-10-31 not changed, skipping.
  2503. Oct 27 20:21:15 localhost epgd: Downloaded 'TAG24' for 2019-10-31 not changed, skipping.
  2504. Oct 27 20:21:15 localhost epgd: Downloaded 'TELE5' for 2019-10-31 with (55216) Bytes, changed since last load.
  2505. Oct 27 20:21:16 localhost epgd: Downloaded 'TLC' for 2019-10-31 not changed, skipping.
  2506. Oct 27 20:21:16 localhost epgd: Downloaded 'TOGGO' for 2019-10-31 not changed, skipping.
  2507. Oct 27 20:21:16 localhost epgd: Downloaded 'VOX' for 2019-10-31 with (55246) Bytes, changed since last load.
  2508. Oct 27 20:21:16 localhost epgd: Downloaded 'WDR' for 2019-10-31 with (61211) Bytes, changed since last load.
  2509. Oct 27 20:21:17 localhost epgd: Downloaded 'WDWTV' for 2019-10-31 not changed, skipping.
  2510. Oct 27 20:21:17 localhost epgd: Downloaded 'ZDF' for 2019-10-31 with (92024) Bytes, changed since last load.
  2511. Oct 27 20:21:18 localhost epgd: Downloaded 'ZINFO' for 2019-10-31 with (110554) Bytes, changed since last load.
  2512. Oct 27 20:21:18 localhost epgd: Downloading images...
  2513. Oct 27 20:21:18 localhost epgd: Downloaded 1 images
  2514. Oct 27 20:21:18 localhost epgd: Updating 'tvm' day today+5 now
  2515. Oct 27 20:21:18 localhost epgd: Skipping day 5 for TVM plugin, since all days ar performed on day 0
  2516. Oct 27 20:21:18 localhost epgd: Updating 'tvsp' day today+5 now
  2517. Oct 27 20:21:18 localhost epgd: Downloaded '2NEO' for 2019-11-01 with (111217) Bytes, changed since last load.
  2518. Oct 27 20:21:19 localhost epgd: Downloaded '3SAT' for 2019-11-01 not changed, skipping.
  2519. Oct 27 20:21:19 localhost epgd: Downloaded 'ALPHA' for 2019-11-01 with (65159) Bytes, changed since last load.
  2520. Oct 27 20:21:19 localhost epgd: Downloaded 'ANIXE' for 2019-11-01 with (43146) Bytes, changed since last load.
  2521. Oct 27 20:21:19 localhost epgd: Downloaded 'ARD' for 2019-11-01 with (66946) Bytes, changed since last load.
  2522. Oct 27 20:21:20 localhost epgd: Downloaded 'ARTE' for 2019-11-01 with (71487) Bytes, changed since last load.
  2523. Oct 27 20:21:20 localhost epgd: Downloaded 'ATV' for 2019-11-01 with (48749) Bytes, changed since last load.
  2524. Oct 27 20:21:20 localhost epgd: Downloaded 'ATV2' for 2019-11-01 with (43623) Bytes, changed since last load.
  2525. Oct 27 20:21:23 localhost epgd: Downloaded 'BBC' for 2019-11-01 not changed, skipping.
  2526. Oct 27 20:21:23 localhost epgd: Downloaded 'BR-S' for 2019-11-01 not changed, skipping.
  2527. Oct 27 20:21:24 localhost epgd: Downloaded 'CC' for 2019-11-01 with (102408) Bytes, changed since last load.
  2528. Oct 27 20:21:25 localhost epgd: Downloaded 'CNBC' for 2019-11-01 not changed, skipping.
  2529. Oct 27 20:21:26 localhost epgd: Downloaded 'DISNE' for 2019-11-01 with (73592) Bytes, changed since last load.
  2530. Oct 27 20:21:28 localhost epgd: Downloaded 'DMAX' for 2019-11-01 with (33237) Bytes, changed since last load.
  2531. Oct 27 20:21:29 localhost epgd: Downloaded 'EURON' for 2019-11-01 not changed, skipping.
  2532. Oct 27 20:21:29 localhost epgd: Downloaded 'FES' for 2019-11-01 with (89067) Bytes, changed since last load.
  2533. Oct 27 20:21:32 localhost epgd: Downloaded 'HR' for 2019-11-01 with (71032) Bytes, changed since last load.
  2534. Oct 27 20:21:34 localhost epgd: Downloaded 'K1' for 2019-11-01 with (48061) Bytes, changed since last load.
  2535. Oct 27 20:21:35 localhost epgd: Downloaded 'K1DOKU' for 2019-11-01 not changed, skipping.
  2536. Oct 27 20:21:36 localhost epgd: Downloaded 'KIKA' for 2019-11-01 with (186587) Bytes, changed since last load.
  2537. Oct 27 20:21:39 localhost epgd: Downloaded 'MDR' for 2019-11-01 with (84507) Bytes, changed since last load.
  2538. Oct 27 20:21:40 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-11-01]
  2539. Oct 27 20:21:40 localhost epgd: Downloaded 'N24' for 2019-11-01 failed, code: 0.
  2540. Oct 27 20:21:40 localhost epgd: Downloaded 'N24DOKU' for 2019-11-01 not changed, skipping.
  2541. Oct 27 20:21:40 localhost epgd: Downloaded 'NDR-HH' for 2019-11-01 with (77519) Bytes, changed since last load.
  2542. Oct 27 20:21:41 localhost epgd: Downloaded 'NICK' for 2019-11-01 with (57635) Bytes, changed since last load.
  2543. Oct 27 20:21:41 localhost epgd: Downloaded 'NTV' for 2019-11-01 not changed, skipping.
  2544. Oct 27 20:21:41 localhost epgd: Downloaded 'OE24TV' for 2019-11-01 not changed, skipping.
  2545. Oct 27 20:21:41 localhost epgd: Downloaded 'ORF1' for 2019-11-01 with (76499) Bytes, changed since last load.
  2546. Oct 27 20:21:42 localhost epgd: Downloaded 'ORF2' for 2019-11-01 not changed, skipping.
  2547. Oct 27 20:21:42 localhost epgd: Downloaded 'ORF3' for 2019-11-01 with (34961) Bytes, changed since last load.
  2548. Oct 27 20:21:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2549. Oct 27 20:21:43 localhost epgd: Downloaded 'ORFSP' for 2019-11-01 not changed, skipping.
  2550. Oct 27 20:21:44 localhost epgd: Downloaded 'PHOEN' for 2019-11-01 not changed, skipping.
  2551. Oct 27 20:21:44 localhost epgd: Downloaded 'PRO7' for 2019-11-01 with (89401) Bytes, changed since last load.
  2552. Oct 27 20:21:45 localhost epgd: Downloaded 'PRO7M' for 2019-11-01 with (64790) Bytes, changed since last load.
  2553. Oct 27 20:21:45 localhost epgd: Downloaded 'PULS4' for 2019-11-01 not changed, skipping.
  2554. Oct 27 20:21:45 localhost epgd: Downloaded 'RB-TV' for 2019-11-01 with (80290) Bytes, changed since last load.
  2555. Oct 27 20:21:45 localhost epgd: Downloaded 'RBB' for 2019-11-01 with (59913) Bytes, changed since last load.
  2556. Oct 27 20:21:46 localhost epgd: Downloaded 'RIC' for 2019-11-01 not changed, skipping.
  2557. Oct 27 20:21:46 localhost epgd: Downloaded 'RTL' for 2019-11-01 not changed, skipping.
  2558. Oct 27 20:21:46 localhost epgd: Downloaded 'RTL-N' for 2019-11-01 with (60002) Bytes, changed since last load.
  2559. Oct 27 20:21:46 localhost epgd: Downloaded 'RTL2' for 2019-11-01 with (28771) Bytes, changed since last load.
  2560. Oct 27 20:21:46 localhost epgd: Downloaded 'SAT1' for 2019-11-01 not changed, skipping.
  2561. Oct 27 20:21:46 localhost epgd: Downloaded 'SAT1G' for 2019-11-01 not changed, skipping.
  2562. Oct 27 20:21:47 localhost epgd: Downloaded 'SERVU' for 2019-11-01 with (75420) Bytes, changed since last load.
  2563. Oct 27 20:21:47 localhost epgd: Downloaded 'SIXX' for 2019-11-01 with (41854) Bytes, changed since last load.
  2564. Oct 27 20:21:47 localhost epgd: Downloaded 'SR' for 2019-11-01 not changed, skipping.
  2565. Oct 27 20:21:47 localhost epgd: Downloaded 'SUPER' for 2019-11-01 not changed, skipping.
  2566. Oct 27 20:21:47 localhost epgd: Downloaded 'SWRBW' for 2019-11-01 not changed, skipping.
  2567. Oct 27 20:21:47 localhost epgd: Downloaded 'TAG24' for 2019-11-01 with (51404) Bytes, changed since last load.
  2568. Oct 27 20:21:48 localhost epgd: Downloaded 'TELE5' for 2019-11-01 with (53234) Bytes, changed since last load.
  2569. Oct 27 20:21:48 localhost epgd: Downloaded 'TLC' for 2019-11-01 not changed, skipping.
  2570. Oct 27 20:21:48 localhost epgd: Downloaded 'TOGGO' for 2019-11-01 not changed, skipping.
  2571. Oct 27 20:21:48 localhost epgd: Downloaded 'VOX' for 2019-11-01 with (52510) Bytes, changed since last load.
  2572. Oct 27 20:21:48 localhost epgd: Downloaded 'WDR' for 2019-11-01 with (62883) Bytes, changed since last load.
  2573. Oct 27 20:21:49 localhost epgd: Downloaded 'WDWTV' for 2019-11-01 not changed, skipping.
  2574. Oct 27 20:21:50 localhost epgd: Downloaded 'ZDF' for 2019-11-01 with (95235) Bytes, changed since last load.
  2575. Oct 27 20:21:50 localhost epgd: Downloaded 'ZINFO' for 2019-11-01 with (95626) Bytes, changed since last load.
  2576. Oct 27 20:21:50 localhost epgd: Downloading images...
  2577. Oct 27 20:21:50 localhost epgd: Downloaded 0 images
  2578. Oct 27 20:21:50 localhost epgd: Updating 'tvm' day today+6 now
  2579. Oct 27 20:21:50 localhost epgd: Skipping day 6 for TVM plugin, since all days ar performed on day 0
  2580. Oct 27 20:21:50 localhost epgd: Updating 'tvsp' day today+6 now
  2581. Oct 27 20:21:50 localhost epgd: Downloaded '2NEO' for 2019-11-02 with (116640) Bytes, changed since last load.
  2582. Oct 27 20:21:51 localhost epgd: Downloaded '3SAT' for 2019-11-02 not changed, skipping.
  2583. Oct 27 20:21:51 localhost epgd: Downloaded 'ALPHA' for 2019-11-02 with (62832) Bytes, changed since last load.
  2584. Oct 27 20:21:51 localhost systemd[1]: Created slice User Slice of daniel.
  2585. Oct 27 20:21:51 localhost systemd[1]: Starting User Manager for UID 1000...
  2586. Oct 27 20:21:51 localhost systemd[1]: Started Session 3 of user daniel.
  2587. Oct 27 20:21:51 localhost systemd[4552]: Reached target Timers.
  2588. Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG network certificate management daemon.
  2589. Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent and passphrase cache (restricted).
  2590. Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent and passphrase cache.
  2591. Oct 27 20:21:51 localhost systemd[4552]: Starting D-Bus User Message Bus Socket.
  2592. Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent (ssh-agent emulation).
  2593. Oct 27 20:21:51 localhost systemd[4552]: Reached target Paths.
  2594. Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent and passphrase cache (access for web browsers).
  2595. Oct 27 20:21:51 localhost systemd[4552]: Listening on D-Bus User Message Bus Socket.
  2596. Oct 27 20:21:51 localhost systemd[4552]: Reached target Sockets.
  2597. Oct 27 20:21:51 localhost systemd[4552]: Reached target Basic System.
  2598. Oct 27 20:21:51 localhost systemd[4552]: Reached target Default.
  2599. Oct 27 20:21:51 localhost systemd[4552]: Startup finished in 50ms.
  2600. Oct 27 20:21:51 localhost epgd: Downloaded 'ANIXE' for 2019-11-02 not changed, skipping.
  2601. Oct 27 20:21:51 localhost systemd[1]: Started User Manager for UID 1000.
  2602. Oct 27 20:21:51 localhost epgd: Downloaded 'ARD' for 2019-11-02 with (94101) Bytes, changed since last load.
  2603. Oct 27 20:21:52 localhost epgd: Downloaded 'ARTE' for 2019-11-02 with (82291) Bytes, changed since last load.
  2604. Oct 27 20:21:53 localhost vdr: video: 23:37:52.723 +13 581 0/\ms 15+6+4 v-buf
  2605. Oct 27 20:21:55 localhost epgd: Downloaded 'ATV' for 2019-11-02 with (27544) Bytes, changed since last load.
  2606. Oct 27 20:21:55 localhost epgd: Downloaded 'ATV2' for 2019-11-02 with (38054) Bytes, changed since last load.
  2607. Oct 27 20:21:55 localhost epgd: Downloaded 'BBC' for 2019-11-02 not changed, skipping.
  2608. Oct 27 20:21:55 localhost epgd: Downloaded 'BR-S' for 2019-11-02 with (74074) Bytes, changed since last load.
  2609. Oct 27 20:21:55 localhost epgd: Downloaded 'CC' for 2019-11-02 with (96529) Bytes, changed since last load.
  2610. Oct 27 20:21:56 localhost epgd: Downloaded 'CNBC' for 2019-11-02 not changed, skipping.
  2611. Oct 27 20:21:56 localhost epgd: Downloaded 'DISNE' for 2019-11-02 with (71690) Bytes, changed since last load.
  2612. Oct 27 20:21:56 localhost epgd: Downloaded 'DMAX' for 2019-11-02 with (31316) Bytes, changed since last load.
  2613. Oct 27 20:21:56 localhost epgd: Downloaded 'EURON' for 2019-11-02 not changed, skipping.
  2614. Oct 27 20:21:57 localhost epgd: Downloaded 'FES' for 2019-11-02 with (74437) Bytes, changed since last load.
  2615. Oct 27 20:21:57 localhost epgd: Downloaded 'HR' for 2019-11-02 not changed, skipping.
  2616. Oct 27 20:21:57 localhost epgd: Downloaded 'K1' for 2019-11-02 with (58875) Bytes, changed since last load.
  2617. Oct 27 20:21:57 localhost epgd: Downloaded 'K1DOKU' for 2019-11-02 with (24276) Bytes, changed since last load.
  2618. Oct 27 20:21:57 localhost epgd: Downloaded 'KIKA' for 2019-11-02 not changed, skipping.
  2619. Oct 27 20:21:58 localhost epgd: Downloaded 'MDR' for 2019-11-02 with (72928) Bytes, changed since last load.
  2620. Oct 27 20:21:58 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-11-02]
  2621. Oct 27 20:21:58 localhost epgd: Downloaded 'N24' for 2019-11-02 failed, code: 0.
  2622. Oct 27 20:21:58 localhost epgd: Downloaded 'N24DOKU' for 2019-11-02 with (28472) Bytes, changed since last load.
  2623. Oct 27 20:21:58 localhost epgd: Downloaded 'NDR-HH' for 2019-11-02 with (72753) Bytes, changed since last load.
  2624. Oct 27 20:21:59 localhost epgd: Downloaded 'NICK' for 2019-11-02 with (57273) Bytes, changed since last load.
  2625. Oct 27 20:22:00 localhost epgd: Downloaded 'NTV' for 2019-11-02 with (45067) Bytes, changed since last load.
  2626. Oct 27 20:22:00 localhost epgd: Downloaded 'OE24TV' for 2019-11-02 not changed, skipping.
  2627. Oct 27 20:22:00 localhost epgd: Downloaded 'ORF1' for 2019-11-02 with (96723) Bytes, changed since last load.
  2628. Oct 27 20:22:00 localhost epgd: Downloaded 'ORF2' for 2019-11-02 with (51257) Bytes, changed since last load.
  2629. Oct 27 20:22:01 localhost epgd: Downloaded 'ORF3' for 2019-11-02 not changed, skipping.
  2630. Oct 27 20:22:01 localhost epgd: Downloaded 'ORFSP' for 2019-11-02 not changed, skipping.
  2631. Oct 27 20:22:01 localhost epgd: Downloaded 'PHOEN' for 2019-11-02 not changed, skipping.
  2632. Oct 27 20:22:01 localhost epgd: Downloaded 'PRO7' for 2019-11-02 with (86158) Bytes, changed since last load.
  2633. Oct 27 20:22:02 localhost epgd: Downloaded 'PRO7M' for 2019-11-02 not changed, skipping.
  2634. Oct 27 20:22:02 localhost epgd: Downloaded 'PULS4' for 2019-11-02 not changed, skipping.
  2635. Oct 27 20:22:02 localhost epgd: Downloaded 'RB-TV' for 2019-11-02 with (73547) Bytes, changed since last load.
  2636. Oct 27 20:22:04 localhost epgd: Downloaded 'RBB' for 2019-11-02 not changed, skipping.
  2637. Oct 27 20:22:04 localhost epgd: Downloaded 'RIC' for 2019-11-02 with (23785) Bytes, changed since last load.
  2638. Oct 27 20:22:04 localhost epgd: Downloaded 'RTL' for 2019-11-02 not changed, skipping.
  2639. Oct 27 20:22:04 localhost epgd: Downloaded 'RTL-N' for 2019-11-02 with (43728) Bytes, changed since last load.
  2640. Oct 27 20:22:05 localhost epgd: Downloaded 'RTL2' for 2019-11-02 with (34000) Bytes, changed since last load.
  2641. Oct 27 20:22:05 localhost epgd: Downloaded 'SAT1' for 2019-11-02 with (28948) Bytes, changed since last load.
  2642. Oct 27 20:22:06 localhost epgd: Downloaded 'SAT1G' for 2019-11-02 with (55028) Bytes, changed since last load.
  2643. Oct 27 20:22:07 localhost epgd: Downloaded 'SERVU' for 2019-11-02 with (71526) Bytes, changed since last load.
  2644. Oct 27 20:22:07 localhost epgd: Downloaded 'SIXX' for 2019-11-02 with (39540) Bytes, changed since last load.
  2645. Oct 27 20:22:07 localhost epgd: Downloaded 'SR' for 2019-11-02 not changed, skipping.
  2646. Oct 27 20:22:07 localhost epgd: Downloaded 'SUPER' for 2019-11-02 with (39736) Bytes, changed since last load.
  2647. Oct 27 20:22:07 localhost epgd: Downloaded 'SWRBW' for 2019-11-02 with (83608) Bytes, changed since last load.
  2648. Oct 27 20:22:08 localhost epgd: Downloaded 'TAG24' for 2019-11-02 not changed, skipping.
  2649. Oct 27 20:22:08 localhost epgd: Downloaded 'TELE5' for 2019-11-02 with (54400) Bytes, changed since last load.
  2650. Oct 27 20:22:08 localhost epgd: Downloaded 'TLC' for 2019-11-02 with (40306) Bytes, changed since last load.
  2651. Oct 27 20:22:09 localhost epgd: Downloaded 'TOGGO' for 2019-11-02 with (35407) Bytes, changed since last load.
  2652. Oct 27 20:22:09 localhost epgd: Downloaded 'VOX' for 2019-11-02 not changed, skipping.
  2653. Oct 27 20:22:09 localhost epgd: Downloaded 'WDR' for 2019-11-02 with (67517) Bytes, changed since last load.
  2654. Oct 27 20:22:10 localhost epgd: Downloaded 'WDWTV' for 2019-11-02 not changed, skipping.
  2655. Oct 27 20:22:10 localhost epgd: Downloaded 'ZDF' for 2019-11-02 with (125392) Bytes, changed since last load.
  2656. Oct 27 20:22:11 localhost epgd: Downloaded 'ZINFO' for 2019-11-02 not changed, skipping.
  2657. Oct 27 20:22:11 localhost epgd: Downloading images...
  2658. Oct 27 20:22:11 localhost epgd: Downloaded 1 images
  2659. Oct 27 20:22:11 localhost epgd: Updating 'tvm' day today+7 now
  2660. Oct 27 20:22:11 localhost epgd: Skipping day 7 for TVM plugin, since all days ar performed on day 0
  2661. Oct 27 20:22:11 localhost epgd: Updating 'tvsp' day today+7 now
  2662. Oct 27 20:22:11 localhost epgd: Downloaded '2NEO' for 2019-11-03 with (117873) Bytes, changed since last load.
  2663. Oct 27 20:22:11 localhost epgd: Downloaded '3SAT' for 2019-11-03 not changed, skipping.
  2664. Oct 27 20:22:11 localhost epgd: Downloaded 'ALPHA' for 2019-11-03 not changed, skipping.
  2665. Oct 27 20:22:11 localhost epgd: Downloaded 'ANIXE' for 2019-11-03 not changed, skipping.
  2666. Oct 27 20:22:11 localhost epgd: Downloaded 'ARD' for 2019-11-03 not changed, skipping.
  2667. Oct 27 20:22:11 localhost epgd: Downloaded 'ARTE' for 2019-11-03 with (87001) Bytes, changed since last load.
  2668. Oct 27 20:22:12 localhost epgd: Downloaded 'ATV' for 2019-11-03 not changed, skipping.
  2669. Oct 27 20:22:12 localhost epgd: Downloaded 'ATV2' for 2019-11-03 not changed, skipping.
  2670. Oct 27 20:22:12 localhost epgd: Downloaded 'BBC' for 2019-11-03 not changed, skipping.
  2671. Oct 27 20:22:12 localhost epgd: Downloaded 'BR-S' for 2019-11-03 with (76137) Bytes, changed since last load.
  2672. Oct 27 20:22:12 localhost epgd: Downloaded 'CC' for 2019-11-03 with (95532) Bytes, changed since last load.
  2673. Oct 27 20:22:13 localhost epgd: Downloaded 'CNBC' for 2019-11-03 not changed, skipping.
  2674. Oct 27 20:22:13 localhost epgd: Downloaded 'DISNE' for 2019-11-03 with (74558) Bytes, changed since last load.
  2675. Oct 27 20:22:13 localhost epgd: Downloaded 'DMAX' for 2019-11-03 with (29427) Bytes, changed since last load.
  2676. Oct 27 20:22:13 localhost epgd: Downloaded 'EURON' for 2019-11-03 not changed, skipping.
  2677. Oct 27 20:22:13 localhost epgd: Downloaded 'FES' for 2019-11-03 with (93609) Bytes, changed since last load.
  2678. Oct 27 20:22:14 localhost epgd: Downloaded 'HR' for 2019-11-03 with (93163) Bytes, changed since last load.
  2679. Oct 27 20:22:15 localhost epgd: Downloaded 'K1' for 2019-11-03 not changed, skipping.
  2680. Oct 27 20:22:15 localhost epgd: Downloaded 'K1DOKU' for 2019-11-03 not changed, skipping.
  2681. Oct 27 20:22:15 localhost epgd: Downloaded 'KIKA' for 2019-11-03 with (142604) Bytes, changed since last load.
  2682. Oct 27 20:22:16 localhost epgd: Downloaded 'MDR' for 2019-11-03 not changed, skipping.
  2683. Oct 27 20:22:16 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-11-03]
  2684. Oct 27 20:22:16 localhost epgd: Downloaded 'N24' for 2019-11-03 failed, code: 0.
  2685. Oct 27 20:22:17 localhost epgd: Downloaded 'N24DOKU' for 2019-11-03 with (33239) Bytes, changed since last load.
  2686. Oct 27 20:22:17 localhost epgd: Downloaded 'NDR-HH' for 2019-11-03 not changed, skipping.
  2687. Oct 27 20:22:17 localhost epgd: Downloaded 'NICK' for 2019-11-03 with (52274) Bytes, changed since last load.
  2688. Oct 27 20:22:17 localhost epgd: Downloaded 'NTV' for 2019-11-03 with (44859) Bytes, changed since last load.
  2689. Oct 27 20:22:18 localhost epgd: Downloaded 'OE24TV' for 2019-11-03 not changed, skipping.
  2690. Oct 27 20:22:18 localhost epgd: Downloaded 'ORF1' for 2019-11-03 with (66887) Bytes, changed since last load.
  2691. Oct 27 20:22:18 localhost epgd: Downloaded 'ORF2' for 2019-11-03 not changed, skipping.
  2692. Oct 27 20:22:18 localhost epgd: Downloaded 'ORF3' for 2019-11-03 not changed, skipping.
  2693. Oct 27 20:22:18 localhost epgd: Downloaded 'ORFSP' for 2019-11-03 not changed, skipping.
  2694. Oct 27 20:22:18 localhost epgd: Downloaded 'PHOEN' for 2019-11-03 not changed, skipping.
  2695. Oct 27 20:22:18 localhost epgd: Downloaded 'PRO7' for 2019-11-03 with (42638) Bytes, changed since last load.
  2696. Oct 27 20:22:18 localhost epgd: Downloaded 'PRO7M' for 2019-11-03 not changed, skipping.
  2697. Oct 27 20:22:18 localhost epgd: Downloaded 'PULS4' for 2019-11-03 not changed, skipping.
  2698. Oct 27 20:22:18 localhost epgd: Downloaded 'RB-TV' for 2019-11-03 not changed, skipping.
  2699. Oct 27 20:22:18 localhost epgd: Downloaded 'RBB' for 2019-11-03 not changed, skipping.
  2700. Oct 27 20:22:19 localhost epgd: Downloaded 'RIC' for 2019-11-03 not changed, skipping.
  2701. Oct 27 20:22:19 localhost epgd: Downloaded 'RTL' for 2019-11-03 not changed, skipping.
  2702. Oct 27 20:22:19 localhost epgd: Downloaded 'RTL-N' for 2019-11-03 with (44717) Bytes, changed since last load.
  2703. Oct 27 20:22:19 localhost epgd: Downloaded 'RTL2' for 2019-11-03 with (50905) Bytes, changed since last load.
  2704. Oct 27 20:22:20 localhost epgd: Downloaded 'SAT1' for 2019-11-03 with (29506) Bytes, changed since last load.
  2705. Oct 27 20:22:21 localhost epgd: Downloaded 'SAT1G' for 2019-11-03 with (69846) Bytes, changed since last load.
  2706. Oct 27 20:22:22 localhost epgd: Downloaded 'SERVU' for 2019-11-03 not changed, skipping.
  2707. Oct 27 20:22:22 localhost epgd: Downloaded 'SIXX' for 2019-11-03 with (47405) Bytes, changed since last load.
  2708. Oct 27 20:22:23 localhost epgd: Downloaded 'SR' for 2019-11-03 with (73676) Bytes, changed since last load.
  2709. Oct 27 20:22:23 localhost epgd: Downloaded 'SUPER' for 2019-11-03 with (36409) Bytes, changed since last load.
  2710. Oct 27 20:22:23 localhost epgd: Downloaded 'SWRBW' for 2019-11-03 with (74037) Bytes, changed since last load.
  2711. Oct 27 20:22:24 localhost epgd: Downloaded 'TAG24' for 2019-11-03 not changed, skipping.
  2712. Oct 27 20:22:24 localhost epgd: Downloaded 'TELE5' for 2019-11-03 with (43341) Bytes, changed since last load.
  2713. Oct 27 20:22:25 localhost epgd: Downloaded 'TLC' for 2019-11-03 not changed, skipping.
  2714. Oct 27 20:22:25 localhost epgd: Downloaded 'TOGGO' for 2019-11-03 not changed, skipping.
  2715. Oct 27 20:22:25 localhost epgd: Downloaded 'VOX' for 2019-11-03 not changed, skipping.
  2716. Oct 27 20:22:25 localhost epgd: Downloaded 'WDR' for 2019-11-03 with (72023) Bytes, changed since last load.
  2717. Oct 27 20:22:27 localhost epgd: Downloaded 'WDWTV' for 2019-11-03 not changed, skipping.
  2718. Oct 27 20:22:27 localhost epgd: Downloaded 'ZDF' for 2019-11-03 with (122000) Bytes, changed since last load.
  2719. Oct 27 20:22:27 localhost epgd: Downloaded 'ZINFO' for 2019-11-03 not changed, skipping.
  2720. Oct 27 20:22:27 localhost epgd: Downloading images...
  2721. Oct 27 20:22:27 localhost epgd: Downloaded 1 images
  2722. Oct 27 20:22:27 localhost epgd: EPG Update finished, loaded 236 files (15.411 MB), 260 non-updates skipped, 0 rejected due to format error.
  2723. Oct 27 20:22:27 localhost epgd: Calling sd_notify(STATUS=Ready)
  2724. Oct 27 20:22:27 localhost epgd: Starting 'update' episode download ...
  2725. Oct 27 20:22:28 localhost epgd: Got 'Setting encoding to utf8'
  2726. Oct 27 20:22:28 localhost epgd: Requesting episode changes of last 753 minutes
  2727. Oct 27 20:22:28 localhost epgd: Received 1 episode files
  2728. Oct 27 20:22:29 localhost epgd: Starting episode lookup ...
  2729. Oct 27 20:22:29 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [ROGERDERGERADESEINABSCHLUSSZEUGNISIMARCHÄOLOGIESTUDIUMERHALTENHATBEKOMMTVONDERFAMILIEEINEHARTEABFUHRNIEMANDWÜRDIGTSEINEERFOLGEDENNSIESEIENALLENURERLOGENUNDERSCHUMMELTFRANCINEBERUHIGTROGERUNDUNTERSTÜ]
  2730. Oct 27 20:22:29 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [ROGERDERGERADESEINABSCHLUSSZEUGNISIMARCHÄOLOGIESTUDIUMERHALTENHATBEKOMMTVONDERFAMILIEEINEHARTEABFUHRNIEMANDWÜRDIGTSEINEERFOLGEDENNSIESEIENALLENURERLOGENUNDERSCHUMMELTFRANCINEBERUHIGTROGERUNDUNTERSTÜ]
  2731. Oct 27 20:22:32 localhost vdr: [1799] [softhddev]SetVolumeDevice: 60
  2732. Oct 27 20:22:32 localhost vdr: [1799] [softhddev]CreateOsd: left 384, top 918, level 0, using OpenGL OSD support
  2733. Oct 27 20:22:32 localhost vdr: [1799] [softhddev]cOglOsd osdLeft 384 osdTop 918 screenWidth 1920 screenHeight 1080
  2734. Oct 27 20:22:32 localhost vdr: [5045] animator thread thread started (pid=1799, tid=5045, prio=high)
  2735. Oct 27 20:22:32 localhost vdr: [1799] [softhddev]SetVolumeDevice: 65
  2736. Oct 27 20:22:32 localhost vdr: [1799] [softhddev]SetVolumeDevice: 70
  2737. Oct 27 20:22:33 localhost vdr: [5045] animator thread thread ended (pid=1799, tid=5045)
  2738. Oct 27 20:22:34 localhost vdr: [1799] [softhddev]SetVolumeDevice: 65
  2739. Oct 27 20:22:34 localhost vdr: [1799] [softhddev]CreateOsd: left 384, top 918, level 0, using OpenGL OSD support
  2740. Oct 27 20:22:34 localhost vdr: [1799] [softhddev]cOglOsd osdLeft 384 osdTop 918 screenWidth 1920 screenHeight 1080
  2741. Oct 27 20:22:34 localhost vdr: [5181] animator thread thread started (pid=1799, tid=5181, prio=high)
  2742. Oct 27 20:22:35 localhost vdr: [5181] animator thread thread ended (pid=1799, tid=5181)
  2743. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIEUNDJOYGEHENMITSIMONAUNDSTEPHENESSENUNDKURZBEVORDERNACHTISCHKOMMTVERABSCHIEDENSIESICHSCHNELLDASIEMORGENSFRÃœHARBEITENMÃœSSENZUMDRITTENMALBLEIBENDAMITSTEPHENUNDSIMONAAUFEINERRESTAURANTRECHNUNGSITZEN]
  2744. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIEUNDJOYGEHENMITSIMONAUNDSTEPHENESSENUNDKURZBEVORDERNACHTISCHKOMMTVERABSCHIEDENSIESICHSCHNELLDASIEMORGENSFRÃœHARBEITENMÃœSSENZUMDRITTENMALBLEIBENDAMITSTEPHENUNDSIMONAAUFEINERRESTAURANTRECHNUNGSITZEN]
  2745. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]
  2746. Oct 27 20:22:36 localhost epgd: message repeated 3 times: [ Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]]
  2747. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIEUNDJOYGEHENMITSIMONAUNDSTEPHENESSENUNDKURZBEVORDERNACHTISCHKOMMTVERABSCHIEDENSIESICHSCHNELLDASIEMORGENSFRÃœHARBEITENMÃœSSENZUMDRITTENMALBLEIBENDAMITSTEPHENUNDSIMONAAUFEINERRESTAURANTRECHNUNGSITZEN]
  2748. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]
  2749. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]
  2750. Oct 27 20:22:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2751. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [CARTMANWIRDSOFORTSTUTZIGALSEINMUSLIMISCHERJUNGENACHSOUTHPARKZIEHTUNDSOBEGINNTEREINEAUFWÄNDIGERECHERCHEDIEZUMERGEBNISHATDASOFFENBARTATSÄCHLICHEINANSCHLAGAUFHILLARYCLINTONWÄHRENDIHRESBESUCHSINSOUTHPARK]
  2752. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [CARTMANWIRDSOFORTSTUTZIGALSEINMUSLIMISCHERJUNGENACHSOUTHPARKZIEHTUNDSOBEGINNTEREINEAUFWÄNDIGERECHERCHEDIEZUMERGEBNISHATDASOFFENBARTATSÄCHLICHEINANSCHLAGAUFHILLARYCLINTONWÄHRENDIHRESBESUCHSINSOUTHPARK]
  2753. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
  2754. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
  2755. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [IMMERWENNMSGARRISONEINENPARTNERVERLORENHATISTSIESOFRUSTRIERTDASSSIEIHREWUTANDENKINDERNIHRERKLASSEAUSLÄSSTDIESERZUSTANDÄNDERTSICHGRUNDLEGENDALSMSGARRISONINEINERLESBENBARIHREGEFÜHLEFÜRSEIGENEGESCHLEC]
  2756. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [IMMERWENNMSGARRISONEINENPARTNERVERLORENHATISTSIESOFRUSTRIERTDASSSIEIHREWUTANDENKINDERNIHRERKLASSEAUSLÄSSTDIESERZUSTANDÄNDERTSICHGRUNDLEGENDALSMSGARRISONINEINERLESBENBARIHREGEFÜHLEFÜRSEIGENEGESCHLEC]
  2757. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [DIESTADTWIRDVONEINERHARLEYMOTORRADGANGHEIMGESUCHTDIEMITIHRENMASCHINENSTÄNDIGLAUTDURCHDIESTRAßENCRUISENCARTMANUNDDIEJUNGSHALTENDIESESPUBERTÄREPROLOTREIBENFÜRHÖCHSTSCHWUCHTELHAFTUNDWOLLENDIEBIKERAUSDERST]
  2758. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [DIESTADTWIRDVONEINERHARLEYMOTORRADGANGHEIMGESUCHTDIEMITIHRENMASCHINENSTÄNDIGLAUTDURCHDIESTRAßENCRUISENCARTMANUNDDIEJUNGSHALTENDIESESPUBERTÄREPROLOTREIBENFÜRHÖCHSTSCHWUCHTELHAFTUNDWOLLENDIEBIKERAUSDERST]
  2759. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
  2760. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
  2761. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [DIEJUNGSVONSOUTHPARKSINDDEMNEUESTENFUNTRENDVERFALLENCHINPOKOMONEINCARTOONAUSJAPANDIEERWACHSENENMACHENSICHSEHRSPÄTERSTGEDANKENÜBERDIEVERÄNDERUNGENIMVERHALTENIHRERKINDERDIENUNALLEPLÖTZLICHJAPANISCHSP]
  2762. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [DIEJUNGSVONSOUTHPARKSINDDEMNEUESTENFUNTRENDVERFALLENCHINPOKOMONEINCARTOONAUSJAPANDIEERWACHSENENMACHENSICHSEHRSPÄTERSTGEDANKENÜBERDIEVERÄNDERUNGENIMVERHALTENIHRERKINDERDIENUNALLEPLÖTZLICHJAPANISCHSP]
  2763. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
  2764. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
  2765. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
  2766. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
  2767. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [SHELLYSOLLAUFCARTMANAUFPASSENWÄHRENDSEINEMUTTERAUFEINERPARTYISTWÄHRENDCARTMANUNDSHELLYLOSZIEHENUMSHELLYSEXFREUNDEINSAUSZUWISCHENFEIERTCARTMANSROLLIGEMIEZEINDERZWISCHENZEITEINEWILDEKATZENORGIEINDEMLEER]
  2768. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [SHELLYSOLLAUFCARTMANAUFPASSENWÄHRENDSEINEMUTTERAUFEINERPARTYISTWÄHRENDCARTMANUNDSHELLYLOSZIEHENUMSHELLYSEXFREUNDEINSAUSZUWISCHENFEIERTCARTMANSROLLIGEMIEZEINDERZWISCHENZEITEINEWILDEKATZENORGIEINDEMLEER]
  2769. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [AUFDERMETEORITENSCHAUERPARTYMUSSSTANMITDEN3GRÖßTENSTREBERNDERSCHULEIMKELLERSPIELENWÄHRENDSEINEELTERNOBENFEIERNSTANSVATERRANDYUNDGERALDFINDENSICHNACKTIMWHIRLPOOLWIEDERUNDBESCHLIEßENIHRENSEXPHANTASIEN]
  2770. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [AUFDERMETEORITENSCHAUERPARTYMUSSSTANMITDEN3GRÖßTENSTREBERNDERSCHULEIMKELLERSPIELENWÄHRENDSEINEELTERNOBENFEIERNSTANSVATERRANDYUNDGERALDFINDENSICHNACKTIMWHIRLPOOLWIEDERUNDBESCHLIEßENIHRENSEXPHANTASIEN]
  2771. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [NACHDEMDIEPANFLÖTENSPIELERVONDENSTRAßENGEHOLTWURDENBRICHTÜBERALLINDENSTÄDTENDASCHAOSAUSRIESIGEMEERSCHWEINCHENATTACKIERENDIEBEWOHNERDIEJUNGSWURDENVONDERNATIONALENSICHERHEITNACHPERUGEBRACHTUMDENGRUNDD]
  2772. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 205) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATALSOBESCHLIEßENDIEJUNGSDIESEZUNÄCH]
  2773. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [MRGARRISONLÄDTDENSEXUELLENBELÄSTIGUNGSPANDAINDENUNTERRICHTEINDAMITDIESCHÜLERALLESÜBERGESETZEZURVERHINDERUNGVONSEXUELLERBELÄSTIGUNGERFAHRENWEGENEINESZWEIDEUTIGENKRAFTAUSDRUCKSVERKLAGTCARTMANSTANDANNAUFS]
  2774. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 205) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATALSOBESCHLIEßENDIEJUNGSDIESEZUNÄCH]
  2775. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 204) [DIESTADTWIRDVONEINERHARLEYMOTORRADGANGHEIMGESUCHTDIEMITIHRENMASCHINENSTÄNDIGLAUTDURCHDIESTRAßENCRUISENCARTMANUNDDIEJUNGSHALTENDIESESPUBERTÄREPROLOTREIBENFÜRHÖCHSTSCHWUCHTELHAFTUNDWOLLENDIEBIKERAUSDER]
  2776. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 205) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERME]
  2777. Oct 27 20:22:50 localhost epgd: Lookup done for 2292 series, matched 19304 parts by compare and 807 parts by lv in 21 seconds; Updated 396
  2778. Oct 27 20:22:50 localhost epgd: Calling 'mergeepg'
  2779. Oct 27 20:22:53 localhost vdr: video: 23:38:52.723 +13 581 0/\ms 15+6+4 v-buf
  2780. Oct 27 20:23:37 localhost vdr: [1932] changing caids of channel 6294 (UHD1 by ASTRA / HD+) from 0 to 1830,1843,1860,186A,186D,9C4,98C,98D,1842,4B64
  2781. Oct 27 20:23:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2782. Oct 27 20:23:53 localhost vdr: video: 23:39:52.723 +13 581 0/\ms 12+6+4 v-buf
  2783. Oct 27 20:24:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2784. Oct 27 20:24:53 localhost vdr: video: 23:40:52.723 +13 645 0/\ms 15+6+4 v-buf
  2785. Oct 27 20:25:01 localhost vdr: [1932] changing pids of channel 8112 (Sky Cinema Action HD) from 767+767=27:0;771=deu@106,772=eng@106:0:0 to 767+767=27:0;771=deu@106:0:0
  2786. Oct 27 20:25:02 localhost vdr: [1932] changing portal name of channel 8146 (Sky Sport 2) from '' to 'Formel 1'
  2787. Oct 27 20:25:02 localhost vdr: [1932] changing name of channel 8196 from '18:00 Formel1 PK,;' to 'F1 Race Control,;'
  2788. Oct 27 20:25:02 localhost vdr: [1932] linking channel 8146 (Sky Sport 2) from none to 8196
RAW Paste Data