API tools faq
paste
Guest User

syslog - Hard-Reset - FB funzt

a guest
Oct 27th, 2019
151
0
Never
Add comment
Not a member of Pastebin yet? Sign Up, it unlocks many cool features!
text 264.58 KB | None | 0 0
raw download clone embed print report
  1. Oct 27 20:17:43 localhost epgd: EPG Update started
  2. Oct 27 20:17:43 localhost epgd: Updating 'tvm' day today+0 now
  3. Oct 27 20:17:43 localhost epgd: Checking tvm id 1
  4. Oct 27 20:18:09 localhost systemd-modules-load[384]: Inserted module 'iscsi_tcp'
  5. Oct 27 20:18:09 localhost systemd-modules-load[384]: Inserted module 'ib_iser'
  6. Oct 27 20:18:09 localhost systemd[1]: Mounted FUSE Control File System.
  7. Oct 27 20:18:09 localhost systemd[1]: Mounted Kernel Configuration File System.
  8. Oct 27 20:18:09 localhost systemd[1]: Starting Flush Journal to Persistent Storage...
  9. Oct 27 20:18:09 localhost blkmapd[424]: open pipe file /run/rpc_pipefs/nfs/blocklayout failed: No such file or directory
  10. Oct 27 20:18:09 localhost systemd[1]: Started Apply Kernel Variables.
  11. Oct 27 20:18:09 localhost systemd[1]: Started Create list of required static device nodes for the current kernel.
  12. Oct 27 20:18:09 localhost systemd[1]: Starting Create Static Device Nodes in /dev...
  13. Oct 27 20:18:09 localhost systemd[1]: Mounted RPC Pipe File System.
  14. Oct 27 20:18:09 localhost systemd[1]: Starting pNFS block layout mapping daemon...
  15. Oct 27 20:18:09 localhost systemd[1]: nfs-blkmap.service: Can't open PID file /run/blkmapd.pid (yet?) after start: No such file or directory
  16. Oct 27 20:18:09 localhost systemd[1]: Started pNFS block layout mapping daemon.
  17. Oct 27 20:18:09 localhost systemd[1]: Mounted NFSD configuration filesystem.
  18. Oct 27 20:18:09 localhost systemd[1]: Started Monitoring of LVM2 mirrors, snapshots etc. using dmeventd or progress polling.
  19. Oct 27 20:18:09 localhost systemd[1]: Started Set the console keyboard layout.
  20. Oct 27 20:18:09 localhost systemd[1]: Started Create Static Device Nodes in /dev.
  21. Oct 27 20:18:09 localhost systemd[1]: Reached target Local File Systems (Pre).
  22. Oct 27 20:18:09 localhost systemd[1]: Starting udev Kernel Device Manager...
  23. Oct 27 20:18:09 localhost systemd[1]: Started udev Kernel Device Manager.
  24. Oct 27 20:18:09 localhost systemd[1]: Starting Show Plymouth Boot Screen...
  25. Oct 27 20:18:09 localhost systemd[1]: Started Show Plymouth Boot Screen.
  26. Oct 27 20:18:09 localhost systemd[1]: Reached target Local Encrypted Volumes.
  27. Oct 27 20:18:09 localhost systemd[1]: Started Forward Password Requests to Plymouth Directory Watch.
  28. Oct 27 20:18:09 localhost systemd[1]: Starting Show Plymouth Boot Screen...
  29. Oct 27 20:18:09 localhost systemd[1]: Started Show Plymouth Boot Screen.
  30. Oct 27 20:18:09 localhost systemd[1]: Started Flush Journal to Persistent Storage.
  31. Oct 27 20:18:09 localhost systemd-udevd[432]: link_config: autonegotiation is unset or enabled, the speed and duplex are not writable.
  32. Oct 27 20:18:09 localhost systemd-udevd[430]: link_config: autonegotiation is unset or enabled, the speed and duplex are not writable.
  33. Oct 27 20:18:09 localhost systemd[1]: Listening on Load/Save RF Kill Switch Status /dev/rfkill Watch.
  34. Oct 27 20:18:09 localhost systemd[1]: Reached target Sound Card.
  35. Oct 27 20:18:09 localhost systemd[1]: Found device WDC_WD30EFRX-68AX9N0 4.
  36. Oct 27 20:18:09 localhost systemd[1]: Starting File System Check on /dev/disk/by-uuid/87a6fe9e-d135-4bfc-906c-a4cf854d0206...
  37. Oct 27 20:18:09 localhost systemd[1]: Started File System Check Daemon to report status.
  38. Oct 27 20:18:09 localhost systemd[1]: Found device KINGSTON_SA400S37120G 2.
  39. Oct 27 20:18:09 localhost systemd[1]: Activating swap /dev/disk/by-uuid/7465d9bf-bdf6-4d0e-846d-1f4231df5e43...
  40. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/demux0.
  41. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/dvr0.
  42. Oct 27 20:18:09 localhost systemd-fsck[652]: /dev/sda4: Journal wird wiederhergestellt
  43. Oct 27 20:18:09 localhost systemd[1]: Activated swap /dev/disk/by-uuid/7465d9bf-bdf6-4d0e-846d-1f4231df5e43.
  44. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/net0.
  45. Oct 27 20:18:09 localhost systemd[1]: Reached target Swap.
  46. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter0/frontend0.
  47. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/demux0.
  48. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/dvr0.
  49. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/net0.
  50. Oct 27 20:18:09 localhost systemd[1]: Found device /dev/dvb/adapter1/frontend0.
  51. Oct 27 20:18:09 localhost systemd[1]: Starting Show Plymouth Boot Screen...
  52. Oct 27 20:18:09 localhost systemd[1]: Started Show Plymouth Boot Screen.
  53. Oct 27 20:18:09 localhost systemd-fsck[652]: /dev/sda4: sauber, 70984/175177728 Dateien, 646892618/700683593 Blöcke
  54. Oct 27 20:18:09 localhost systemd[1]: Started File System Check on /dev/disk/by-uuid/87a6fe9e-d135-4bfc-906c-a4cf854d0206.
  55. Oct 27 20:18:09 localhost systemd[1]: Mounting /srv...
  56. Oct 27 20:18:09 localhost systemd[1]: Mounted /srv.
  57. Oct 27 20:18:09 localhost systemd[1]: Reached target Local File Systems.
  58. Oct 27 20:18:09 localhost systemd[1]: Starting Preprocess NFS configuration...
  59. Oct 27 20:18:09 localhost systemd[1]: Starting AppArmor initialization...
  60. Oct 27 20:18:09 localhost systemd[1]: Starting Set console font and keymap...
  61. Oct 27 20:18:09 localhost systemd[1]: Starting Create Volatile Files and Directories...
  62. Oct 27 20:18:09 localhost systemd[1]: Starting ebtables ruleset management...
  63. Oct 27 20:18:09 localhost systemd[1]: Starting Tell Plymouth To Write Out Runtime Data...
  64. Oct 27 20:18:09 localhost systemd[1]: Started Preprocess NFS configuration.
  65. Oct 27 20:18:09 localhost systemd[1]: Reached target NFS client services.
  66. Oct 27 20:18:09 localhost systemd[1]: Starting NFSv4 ID-name mapping service...
  67. Oct 27 20:18:09 localhost systemd[1]: Started Set console font and keymap.
  68. Oct 27 20:18:09 localhost systemd[1]: Started NFSv4 ID-name mapping service.
  69. Oct 27 20:18:09 localhost systemd[1]: Started Tell Plymouth To Write Out Runtime Data.
  70. Oct 27 20:18:09 localhost systemd[1]: Started Create Volatile Files and Directories.
  71. Oct 27 20:18:09 localhost systemd[1]: Starting Update UTMP about System Boot/Shutdown...
  72. Oct 27 20:18:09 localhost systemd[1]: Starting Network Time Synchronization...
  73. Oct 27 20:18:09 localhost systemd[1]: Starting RPC bind portmap service...
  74. Oct 27 20:18:09 localhost systemd[1]: Started RPC bind portmap service.
  75. Oct 27 20:18:09 localhost systemd[1]: Reached target RPC Port Mapper.
  76. Oct 27 20:18:09 localhost systemd[1]: Started Update UTMP about System Boot/Shutdown.
  77. Oct 27 20:18:09 localhost systemd[1]: Received SIGRTMIN+20 from PID 280 (plymouthd).
  78. Oct 27 20:18:09 localhost systemd[1]: Started ebtables ruleset management.
  79. Oct 27 20:18:09 localhost apparmor[728]: * Starting AppArmor profiles
  80. Oct 27 20:18:09 localhost systemd[1]: Reached target Network (Pre).
  81. Oct 27 20:18:09 localhost systemd[1]: Starting Network Service...
  82. Oct 27 20:18:09 localhost systemd-networkd[765]: Enumeration completed
  83. Oct 27 20:18:09 localhost systemd[1]: Started Network Service.
  84. Oct 27 20:18:09 localhost systemd-networkd[765]: lo: Link is not managed by us
  85. Oct 27 20:18:09 localhost systemd-networkd[765]: enp5s0: IPv6 successfully enabled
  86. Oct 27 20:18:09 localhost systemd[1]: Starting Network Name Resolution...
  87. Oct 27 20:18:09 localhost systemd[1]: Starting Wait for Network to be Configured...
  88. Oct 27 20:18:09 localhost systemd-networkd-wait-online[791]: ignoring: lo
  89. Oct 27 20:18:09 localhost systemd[1]: Started Network Time Synchronization.
  90. Oct 27 20:18:09 localhost systemd[1]: Reached target System Time Synchronized.
  91. Oct 27 20:18:09 localhost systemd-networkd-wait-online[791]: ignoring: lo
  92. Oct 27 20:18:09 localhost systemd-networkd[765]: enp5s0: Gained carrier
  93. Oct 27 20:18:09 localhost systemd-networkd-wait-online[791]: ignoring: lo
  94. Oct 27 20:18:09 localhost systemd-timesyncd[762]: Network configuration changed, trying to establish connection.
  95. Oct 27 20:18:09 localhost apparmor[728]: Skipping profile in /etc/apparmor.d/disable: usr.bin.firefox
  96. Oct 27 20:18:09 localhost apparmor[728]: Skipping profile in /etc/apparmor.d/disable: usr.sbin.rsyslogd
  97. Oct 27 20:18:09 localhost apparmor[728]: ...done.
  98. Oct 27 20:18:09 localhost systemd-resolved[790]: Positive Trust Anchors:
  99. Oct 27 20:18:09 localhost systemd-resolved[790]: . IN DS 19036 8 2 49aac11d7b6f6446702e54a1607371607a1a41855200fd2ce1cdde32f24e8fb5
  100. Oct 27 20:18:09 localhost systemd-resolved[790]: . IN DS 20326 8 2 e06d44b80b8f1d39a95c0b0d7c65d08458e880409bbc683457104237c7f8ec8d
  101. Oct 27 20:18:09 localhost systemd-resolved[790]: Negative trust anchors: 10.in-addr.arpa 16.172.in-addr.arpa 17.172.in-addr.arpa 18.172.in-addr.arpa 19.172.in-addr.arpa 20.172.in-addr.arpa 21.172.in-addr.arpa 22.172.in-addr.arpa 23.172.in-addr.arpa 24.172.in-addr.arpa 25.172.in-addr.arpa 26.172.in-addr.arpa 27.172.in-addr.arpa 28.172.in-addr.arpa 29.172.in-addr.arpa 30.172.in-addr.arpa 31.172.in-addr.arpa 168.192.in-addr.arpa d.f.ip6.arpa corp home internal intranet lan local private test
  102. Oct 27 20:18:09 localhost systemd-resolved[790]: Using system hostname 'myVDR'.
  103. Oct 27 20:18:09 localhost systemd[1]: Started Network Name Resolution.
  104. Oct 27 20:18:09 localhost systemd[1]: Reached target Host and Network Name Lookups.
  105. Oct 27 20:18:09 localhost systemd[1]: Started AppArmor initialization.
  106. Oct 27 20:18:09 localhost systemd[1]: Reached target System Initialization.
  107. Oct 27 20:18:09 localhost systemd[1]: Listening on ACPID Listen Socket.
  108. Oct 27 20:18:09 localhost systemd[1]: Listening on Open-iSCSI iscsid Socket.
  109. Oct 27 20:18:09 localhost systemd[1]: Listening on Avahi mDNS/DNS-SD Stack Activation Socket.
  110. Oct 27 20:18:09 localhost systemd[1]: Started ACPI Events Check.
  111. Oct 27 20:18:09 localhost systemd[1]: Started Daily apt download activities.
  112. Oct 27 20:18:09 localhost systemd[1]: Listening on eventlircd.socket.
  113. Oct 27 20:18:09 localhost systemd[1]: Starting Socket activation for snappy daemon.
  114. Oct 27 20:18:09 localhost systemd[1]: Listening on UUID daemon activation socket.
  115. Oct 27 20:18:09 localhost systemd[1]: Started Trigger anacron every hour.
  116. Oct 27 20:18:09 localhost systemd[1]: Started Discard unused blocks once a week.
  117. Oct 27 20:18:09 localhost systemd[1]: Listening on D-Bus System Message Bus Socket.
  118. Oct 27 20:18:09 localhost systemd[1]: Started Daily Cleanup of Temporary Directories.
  119. Oct 27 20:18:09 localhost systemd[1]: Started Daily apt upgrade and clean activities.
  120. Oct 27 20:18:09 localhost systemd[1]: Started Message of the Day.
  121. Oct 27 20:18:09 localhost systemd[1]: Reached target Timers.
  122. Oct 27 20:18:09 localhost systemd[1]: Starting LXD - unix socket.
  123. Oct 27 20:18:09 localhost systemd[1]: Reached target Paths.
  124. Oct 27 20:18:09 localhost systemd[1]: Listening on Socket activation for snappy daemon.
  125. Oct 27 20:18:09 localhost systemd[1]: Listening on LXD - unix socket.
  126. Oct 27 20:18:09 localhost systemd[1]: Reached target Sockets.
  127. Oct 27 20:18:09 localhost systemd[1]: Reached target Basic System.
  128. Oct 27 20:18:09 localhost systemd[1]: Started Run anacron jobs.
  129. Oct 27 20:18:09 localhost systemd[1]: Starting LXD - container startup/shutdown...
  130. Oct 27 20:18:09 localhost systemd[1]: Started VDR ACPI power button handling daemon.
  131. Oct 27 20:18:09 localhost anacron[849]: Anacron 2.3 started on 2019-10-27
  132. Oct 27 20:18:09 localhost systemd[1]: Starting wait-for-dvb@0.service...
  133. Oct 27 20:18:09 localhost systemd[1]: Started Handle events from IR remotes decoded by lircd(8).
  134. Oct 27 20:18:09 localhost anacron[849]: Normal exit (0 jobs run)
  135. Oct 27 20:18:09 localhost systemd[1]: Started "eventlircd reads from kernel input devices and generates key presses on a lircd socket".
  136. Oct 27 20:18:09 localhost wait-for-dvb: got device 0
  137. Oct 27 20:18:09 localhost systemd[1]: Started Deferred execution scheduler.
  138. Oct 27 20:18:09 localhost systemd[1]: Starting Avahi mDNS/DNS-SD Stack...
  139. Oct 27 20:18:09 localhost systemd[1]: Starting wait-for-dvb@1.service...
  140. Oct 27 20:18:09 localhost systemd[1]: Starting Dispatcher daemon for systemd-networkd...
  141. Oct 27 20:18:09 localhost systemd[1]: Starting Login Service...
  142. Oct 27 20:18:09 localhost wait-for-dvb: got device 1
  143. Oct 27 20:18:09 localhost systemd[1]: Started Regular background program processing daemon.
  144. Oct 27 20:18:09 localhost systemd[1]: Starting LSB: Record successful boot for GRUB...
  145. Oct 27 20:18:09 localhost systemd[1]: Starting System Logging Service...
  146. Oct 27 20:18:09 localhost cron[869]: (CRON) INFO (pidfile fd = 3)
  147. Oct 27 20:18:09 localhost systemd[1]: Started Set the CPU Frequency Scaling governor.
  148. Oct 27 20:18:09 localhost systemd[1]: Starting Snappy daemon...
  149. Oct 27 20:18:09 localhost systemd[1]: Starting Initialize hardware monitoring sensors...
  150. Oct 27 20:18:09 localhost systemd[1]: Started irqbalance daemon.
  151. Oct 27 20:18:09 localhost systemd[1]: Started FUSE filesystem for LXC.
  152. Oct 27 20:18:09 localhost systemd[1]: Starting lircd(8) initialization helper tool...
  153. Oct 27 20:18:09 localhost systemd[1]: Starting Disk Manager...
  154. Oct 27 20:18:09 localhost systemd[1]: Starting Save/Restore Sound Card State...
  155. Oct 27 20:18:09 localhost systemd[1]: Starting Accounts Service...
  156. Oct 27 20:18:09 localhost systemd[1]: Started D-Bus System Message Bus.
  157. Oct 27 20:18:09 localhost dbus-daemon[883]: [system] AppArmor D-Bus mediation is enabled
  158. Oct 27 20:18:09 localhost systemd[1]: Starting WPA supplicant...
  159. Oct 27 20:18:09 localhost systemd[1]: Started lifeguard for system services.
  160. Oct 27 20:18:09 localhost systemd[1]: Started wait-for-dvb@0.service.
  161. Oct 27 20:18:09 localhost systemd[1]: Started wait-for-dvb@1.service.
  162. Oct 27 20:18:09 localhost avahi-daemon[860]: Found user 'avahi' (UID 113) and group 'avahi' (GID 117).
  163. Oct 27 20:18:09 localhost kernel: [ 0.000000] microcode: microcode updated early to revision 0x2f, date = 2019-02-17
  164. Oct 27 20:18:09 localhost kernel: [ 0.000000] Linux version 4.15.0-66-generic (buildd@lgw01-amd64-044) (gcc version 7.4.0 (Ubuntu 7.4.0-1ubuntu1~18.04.1)) #75-Ubuntu SMP Tue Oct 1 05:24:09 UTC 2019 (Ubuntu 4.15.0-66.75-generic 4.15.18)
  165. Oct 27 20:18:09 localhost kernel: [ 0.000000] Command line: BOOT_IMAGE=/boot/vmlinuz-4.15.0-66-generic root=UUID=3a2488fb-8ae8-4722-b647-c95071d7e0af ro quiet splash vt.handoff=1
  166. Oct 27 20:18:09 localhost kernel: [ 0.000000] KERNEL supported cpus:
  167. Oct 27 20:18:09 localhost kernel: [ 0.000000] Intel GenuineIntel
  168. Oct 27 20:18:09 localhost kernel: [ 0.000000] AMD AuthenticAMD
  169. Oct 27 20:18:09 localhost kernel: [ 0.000000] Centaur CentaurHauls
  170. Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/fpu: Supporting XSAVE feature 0x001: 'x87 floating point registers'
  171. Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/fpu: Supporting XSAVE feature 0x002: 'SSE registers'
  172. Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/fpu: Enabled xstate features 0x3, context size is 576 bytes, using 'standard' format.
  173. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: BIOS-provided physical RAM map:
  174. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x0000000000000000-0x000000000009d7ff] usable
  175. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x000000000009d800-0x000000000009ffff] reserved
  176. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000000e0000-0x00000000000fffff] reserved
  177. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x0000000000100000-0x00000000df58ffff] usable
  178. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df590000-0x00000000df5d5fff] ACPI NVS
  179. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df5d6000-0x00000000df5ddfff] ACPI data
  180. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df5de000-0x00000000df60afff] reserved
  181. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df60b000-0x00000000df60bfff] usable
  182. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df60c000-0x00000000df60cfff] ACPI data
  183. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df60d000-0x00000000df615fff] ACPI NVS
  184. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df616000-0x00000000df63dfff] reserved
  185. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df63e000-0x00000000df680fff] ACPI NVS
  186. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000df681000-0x00000000df7fffff] usable
  187. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000fed1c000-0x00000000fed3ffff] reserved
  188. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x00000000ff000000-0x00000000ffffffff] reserved
  189. Oct 27 20:18:09 localhost kernel: [ 0.000000] BIOS-e820: [mem 0x0000000100000000-0x000000011f7fffff] usable
  190. Oct 27 20:18:09 localhost kernel: [ 0.000000] NX (Execute Disable) protection: active
  191. Oct 27 20:18:09 localhost kernel: [ 0.000000] SMBIOS 2.7 present.
  192. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMI: To Be Filled By O.E.M. To Be Filled By O.E.M./H61M-GE, BIOS P1.30 08/31/2011
  193. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: update [mem 0x00000000-0x00000fff] usable ==> reserved
  194. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: remove [mem 0x000a0000-0x000fffff] usable
  195. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: last_pfn = 0x11f800 max_arch_pfn = 0x400000000
  196. Oct 27 20:18:09 localhost kernel: [ 0.000000] MTRR default type: uncachable
  197. Oct 27 20:18:09 localhost kernel: [ 0.000000] MTRR fixed ranges enabled:
  198. Oct 27 20:18:09 localhost kernel: [ 0.000000] 00000-9FFFF write-back
  199. Oct 27 20:18:09 localhost kernel: [ 0.000000] A0000-BFFFF uncachable
  200. Oct 27 20:18:09 localhost kernel: [ 0.000000] C0000-CFFFF write-protect
  201. Oct 27 20:18:09 localhost kernel: [ 0.000000] D0000-E7FFF uncachable
  202. Oct 27 20:18:09 localhost kernel: [ 0.000000] E8000-FFFFF write-protect
  203. Oct 27 20:18:09 localhost kernel: [ 0.000000] MTRR variable ranges enabled:
  204. Oct 27 20:18:09 localhost kernel: [ 0.000000] 0 base 000000000 mask F00000000 write-back
  205. Oct 27 20:18:09 localhost kernel: [ 0.000000] 1 base 100000000 mask FE0000000 write-back
  206. Oct 27 20:18:09 localhost kernel: [ 0.000000] 2 base 0E0000000 mask FE0000000 uncachable
  207. Oct 27 20:18:09 localhost kernel: [ 0.000000] 3 base 11F800000 mask FFF800000 uncachable
  208. Oct 27 20:18:09 localhost kernel: [ 0.000000] 4 disabled
  209. Oct 27 20:18:09 localhost kernel: [ 0.000000] 5 disabled
  210. Oct 27 20:18:09 localhost kernel: [ 0.000000] 6 disabled
  211. Oct 27 20:18:09 localhost kernel: [ 0.000000] 7 disabled
  212. Oct 27 20:18:09 localhost kernel: [ 0.000000] 8 disabled
  213. Oct 27 20:18:09 localhost kernel: [ 0.000000] 9 disabled
  214. Oct 27 20:18:09 localhost kernel: [ 0.000000] x86/PAT: Configuration [0-7]: WB WC UC- UC WB WP UC- WT
  215. Oct 27 20:18:09 localhost kernel: [ 0.000000] total RAM covered: 4088M
  216. Oct 27 20:18:09 localhost kernel: [ 0.000000] Found optimal setting for mtrr clean up
  217. Oct 27 20:18:09 localhost kernel: [ 0.000000] gran_size: 64K chunk_size: 16M num_reg: 5 lose cover RAM: 0G
  218. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: update [mem 0xe0000000-0xffffffff] usable ==> reserved
  219. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: last_pfn = 0xdf800 max_arch_pfn = 0x400000000
  220. Oct 27 20:18:09 localhost kernel: [ 0.000000] found SMP MP-table at [mem 0x000fceb0-0x000fcebf]
  221. Oct 27 20:18:09 localhost kernel: [ 0.000000] Scanning 1 areas for low memory corruption
  222. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38141000, 0x38141fff] PGTABLE
  223. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38142000, 0x38142fff] PGTABLE
  224. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38143000, 0x38143fff] PGTABLE
  225. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38144000, 0x38144fff] PGTABLE
  226. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38145000, 0x38145fff] PGTABLE
  227. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38146000, 0x38146fff] PGTABLE
  228. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38147000, 0x38147fff] PGTABLE
  229. Oct 27 20:18:09 localhost kernel: [ 0.000000] BRK [0x38148000, 0x38148fff] PGTABLE
  230. Oct 27 20:18:09 localhost kernel: [ 0.000000] RAMDISK: [mem 0x2f9c9000-0x33cdbfff]
  231. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Early table checksum verification disabled
  232. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: RSDP 0x00000000000F0450 000024 (v02 ALASKA)
  233. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: XSDT 0x00000000DF5D6068 000054 (v01 ALASKA A M I 01072009 AMI 00010013)
  234. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: FACP 0x00000000DF5DD6A8 0000F4 (v04 ALASKA A M I 01072009 AMI 00010013)
  235. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: DSDT 0x00000000DF5D6150 007556 (v02 ALASKA A M I 00000000 INTL 20051117)
  236. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: FACS 0x00000000DF60DF80 000040
  237. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: APIC 0x00000000DF5DD7A0 000062 (v03 ALASKA A M I 01072009 AMI 00010013)
  238. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: SSDT 0x00000000DF5DD808 000098 (v01 AMICPU PROC 00000001 MSFT 03000001)
  239. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: MCFG 0x00000000DF5DD8A0 00003C (v01 ALASKA A M I 01072009 MSFT 00000097)
  240. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: AAFT 0x00000000DF5DD8E0 0000BA (v01 ALASKA OEMAAFT 01072009 MSFT 00000097)
  241. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: HPET 0x00000000DF5DD9A0 000038 (v01 ALASKA A M I 01072009 AMI. 00000004)
  242. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Local APIC address 0xfee00000
  243. Oct 27 20:18:09 localhost kernel: [ 0.000000] No NUMA configuration found
  244. Oct 27 20:18:09 localhost kernel: [ 0.000000] Faking a node at [mem 0x0000000000000000-0x000000011f7fffff]
  245. Oct 27 20:18:09 localhost kernel: [ 0.000000] NODE_DATA(0) allocated [mem 0x11f7d3000-0x11f7fdfff]
  246. Oct 27 20:18:09 localhost kernel: [ 0.000000] tsc: Fast TSC calibration using PIT
  247. Oct 27 20:18:09 localhost kernel: [ 0.000000] Zone ranges:
  248. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA [mem 0x0000000000001000-0x0000000000ffffff]
  249. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA32 [mem 0x0000000001000000-0x00000000ffffffff]
  250. Oct 27 20:18:09 localhost kernel: [ 0.000000] Normal [mem 0x0000000100000000-0x000000011f7fffff]
  251. Oct 27 20:18:09 localhost kernel: [ 0.000000] Device empty
  252. Oct 27 20:18:09 localhost kernel: [ 0.000000] Movable zone start for each node
  253. Oct 27 20:18:09 localhost kernel: [ 0.000000] Early memory node ranges
  254. Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x0000000000001000-0x000000000009cfff]
  255. Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x0000000000100000-0x00000000df58ffff]
  256. Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x00000000df60b000-0x00000000df60bfff]
  257. Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x00000000df681000-0x00000000df7fffff]
  258. Oct 27 20:18:09 localhost kernel: [ 0.000000] node 0: [mem 0x0000000100000000-0x000000011f7fffff]
  259. Oct 27 20:18:09 localhost kernel: [ 0.000000] Reserved but unavailable: 100 pages
  260. Oct 27 20:18:09 localhost kernel: [ 0.000000] Initmem setup node 0 [mem 0x0000000000001000-0x000000011f7fffff]
  261. Oct 27 20:18:09 localhost kernel: [ 0.000000] On node 0 totalpages: 1044140
  262. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA zone: 64 pages used for memmap
  263. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA zone: 21 pages reserved
  264. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA zone: 3996 pages, LIFO batch:0
  265. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA32 zone: 14237 pages used for memmap
  266. Oct 27 20:18:09 localhost kernel: [ 0.000000] DMA32 zone: 911120 pages, LIFO batch:31
  267. Oct 27 20:18:09 localhost kernel: [ 0.000000] Normal zone: 2016 pages used for memmap
  268. Oct 27 20:18:09 localhost kernel: [ 0.000000] Normal zone: 129024 pages, LIFO batch:31
  269. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: PM-Timer IO Port: 0x408
  270. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Local APIC address 0xfee00000
  271. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: LAPIC_NMI (acpi_id[0xff] high edge lint[0x1])
  272. Oct 27 20:18:09 localhost kernel: [ 0.000000] IOAPIC[0]: apic_id 0, version 32, address 0xfec00000, GSI 0-23
  273. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: INT_SRC_OVR (bus 0 bus_irq 0 global_irq 2 dfl dfl)
  274. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: INT_SRC_OVR (bus 0 bus_irq 9 global_irq 9 high level)
  275. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: IRQ0 used by override.
  276. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: IRQ9 used by override.
  277. Oct 27 20:18:09 localhost kernel: [ 0.000000] Using ACPI (MADT) for SMP configuration information
  278. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: HPET id: 0x8086a701 base: 0xfed00000
  279. Oct 27 20:18:09 localhost kernel: [ 0.000000] smpboot: Allowing 2 CPUs, 0 hotplug CPUs
  280. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x00000000-0x00000fff]
  281. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x0009d000-0x0009dfff]
  282. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x0009e000-0x0009ffff]
  283. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x000a0000-0x000dffff]
  284. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0x000e0000-0x000fffff]
  285. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf590000-0xdf5d5fff]
  286. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf5d6000-0xdf5ddfff]
  287. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf5de000-0xdf60afff]
  288. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf60c000-0xdf60cfff]
  289. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf60d000-0xdf615fff]
  290. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf616000-0xdf63dfff]
  291. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf63e000-0xdf680fff]
  292. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xdf800000-0xfed1bfff]
  293. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xfed1c000-0xfed3ffff]
  294. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xfed40000-0xfeffffff]
  295. Oct 27 20:18:09 localhost kernel: [ 0.000000] PM: Registered nosave memory: [mem 0xff000000-0xffffffff]
  296. Oct 27 20:18:09 localhost kernel: [ 0.000000] e820: [mem 0xdf800000-0xfed1bfff] available for PCI devices
  297. Oct 27 20:18:09 localhost kernel: [ 0.000000] Booting paravirtualized kernel on bare hardware
  298. Oct 27 20:18:09 localhost kernel: [ 0.000000] clocksource: refined-jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 7645519600211568 ns
  299. Oct 27 20:18:09 localhost kernel: [ 0.000000] random: get_random_bytes called from start_kernel+0x99/0x4fd with crng_init=0
  300. Oct 27 20:18:09 localhost kernel: [ 0.000000] setup_percpu: NR_CPUS:8192 nr_cpumask_bits:2 nr_cpu_ids:2 nr_node_ids:1
  301. Oct 27 20:18:09 localhost kernel: [ 0.000000] percpu: Embedded 46 pages/cpu s151552 r8192 d28672 u1048576
  302. Oct 27 20:18:09 localhost kernel: [ 0.000000] pcpu-alloc: s151552 r8192 d28672 u1048576 alloc=1*2097152
  303. Oct 27 20:18:09 localhost kernel: [ 0.000000] pcpu-alloc: [0] 0 1
  304. Oct 27 20:18:09 localhost kernel: [ 0.000000] Built 1 zonelists, mobility grouping on. Total pages: 1027802
  305. Oct 27 20:18:09 localhost kernel: [ 0.000000] Policy zone: Normal
  306. Oct 27 20:18:09 localhost kernel: [ 0.000000] Kernel command line: BOOT_IMAGE=/boot/vmlinuz-4.15.0-66-generic root=UUID=3a2488fb-8ae8-4722-b647-c95071d7e0af ro quiet splash vt.handoff=1
  307. Oct 27 20:18:09 localhost kernel: [ 0.000000] Calgary: detecting Calgary via BIOS EBDA area
  308. Oct 27 20:18:09 localhost kernel: [ 0.000000] Calgary: Unable to locate Rio Grande table in EBDA - bailing!
  309. Oct 27 20:18:09 localhost kernel: [ 0.000000] Memory: 3947744K/4176560K available (12300K kernel code, 2481K rwdata, 4260K rodata, 2436K init, 2388K bss, 228816K reserved, 0K cma-reserved)
  310. Oct 27 20:18:09 localhost kernel: [ 0.000000] SLUB: HWalign=64, Order=0-3, MinObjects=0, CPUs=2, Nodes=1
  311. Oct 27 20:18:09 localhost kernel: [ 0.000000] Kernel/User page tables isolation: enabled
  312. Oct 27 20:18:09 localhost kernel: [ 0.000000] ftrace: allocating 39306 entries in 154 pages
  313. Oct 27 20:18:09 localhost kernel: [ 0.000000] Hierarchical RCU implementation.
  314. Oct 27 20:18:09 localhost kernel: [ 0.000000] RCU restricting CPUs from NR_CPUS=8192 to nr_cpu_ids=2.
  315. Oct 27 20:18:09 localhost kernel: [ 0.000000] Tasks RCU enabled.
  316. Oct 27 20:18:09 localhost kernel: [ 0.000000] RCU: Adjusting geometry for rcu_fanout_leaf=16, nr_cpu_ids=2
  317. Oct 27 20:18:09 localhost kernel: [ 0.000000] NR_IRQS: 524544, nr_irqs: 440, preallocated irqs: 16
  318. Oct 27 20:18:09 localhost kernel: [ 0.000000] vt handoff: transparent VT on vt#1
  319. Oct 27 20:18:09 localhost kernel: [ 0.000000] Console: colour dummy device 80x25
  320. Oct 27 20:18:09 localhost kernel: [ 0.000000] console [tty0] enabled
  321. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: Core revision 20170831
  322. Oct 27 20:18:09 localhost kernel: [ 0.000000] ACPI: 2 ACPI AML tables successfully acquired and loaded
  323. Oct 27 20:18:09 localhost kernel: [ 0.000000] clocksource: hpet: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 133484882848 ns
  324. Oct 27 20:18:09 localhost kernel: [ 0.000000] hpet clockevent registered
  325. Oct 27 20:18:09 localhost kernel: [ 0.000000] APIC: Switch to symmetric I/O mode setup
  326. Oct 27 20:18:09 localhost kernel: [ 0.000000] ..TIMER: vector=0x30 apic1=0 pin1=2 apic2=-1 pin2=-1
  327. Oct 27 20:18:09 localhost kernel: [ 0.020000] tsc: Fast TSC calibration using PIT
  328. Oct 27 20:18:09 localhost kernel: [ 0.024000] tsc: Detected 2394.533 MHz processor
  329. Oct 27 20:18:09 localhost kernel: [ 0.024000] Calibrating delay loop (skipped), value calculated using timer frequency.. 4789.06 BogoMIPS (lpj=9578132)
  330. Oct 27 20:18:09 localhost kernel: [ 0.024000] pid_max: default: 32768 minimum: 301
  331. Oct 27 20:18:09 localhost kernel: [ 0.024000] Security Framework initialized
  332. Oct 27 20:18:09 localhost kernel: [ 0.024000] Yama: becoming mindful.
  333. Oct 27 20:18:09 localhost kernel: [ 0.024000] AppArmor: AppArmor initialized
  334. Oct 27 20:18:09 localhost kernel: [ 0.024000] Dentry cache hash table entries: 524288 (order: 10, 4194304 bytes)
  335. Oct 27 20:18:09 localhost kernel: [ 0.024000] Inode-cache hash table entries: 262144 (order: 9, 2097152 bytes)
  336. Oct 27 20:18:09 localhost kernel: [ 0.024000] Mount-cache hash table entries: 8192 (order: 4, 65536 bytes)
  337. Oct 27 20:18:09 localhost kernel: [ 0.024000] Mountpoint-cache hash table entries: 8192 (order: 4, 65536 bytes)
  338. Oct 27 20:18:09 localhost kernel: [ 0.024000] ENERGY_PERF_BIAS: Set to 'normal', was 'performance'
  339. Oct 27 20:18:09 localhost kernel: [ 0.024000] ENERGY_PERF_BIAS: View and update with x86_energy_perf_policy(8)
  340. Oct 27 20:18:09 localhost kernel: [ 0.024000] CPU0: Thermal monitoring enabled (TM1)
  341. Oct 27 20:18:09 localhost kernel: [ 0.024000] process: using mwait in idle threads
  342. Oct 27 20:18:09 localhost kernel: [ 0.024000] Last level iTLB entries: 4KB 512, 2MB 8, 4MB 8
  343. Oct 27 20:18:09 localhost kernel: [ 0.024000] Last level dTLB entries: 4KB 512, 2MB 32, 4MB 32, 1GB 0
  344. Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V1 : Mitigation: usercopy/swapgs barriers and __user pointer sanitization
  345. Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : Mitigation: Full generic retpoline
  346. Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : Spectre v2 / SpectreRSB mitigation: Filling RSB on context switch
  347. Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : Enabling Restricted Speculation for firmware calls
  348. Oct 27 20:18:09 localhost kernel: [ 0.024000] Spectre V2 : mitigation: Enabling conditional Indirect Branch Prediction Barrier
  349. Oct 27 20:18:09 localhost kernel: [ 0.024000] Speculative Store Bypass: Mitigation: Speculative Store Bypass disabled via prctl and seccomp
  350. Oct 27 20:18:09 localhost kernel: [ 0.024000] MDS: Mitigation: Clear CPU buffers
  351. Oct 27 20:18:09 localhost kernel: [ 0.024000] Freeing SMP alternatives memory: 36K
  352. Oct 27 20:18:09 localhost kernel: [ 0.031329] TSC deadline timer enabled
  353. Oct 27 20:18:09 localhost kernel: [ 0.031332] smpboot: CPU0: Intel(R) Celeron(R) CPU G530 @ 2.40GHz (family: 0x6, model: 0x2a, stepping: 0x7)
  354. Oct 27 20:18:09 localhost kernel: [ 0.031410] Performance Events: PEBS fmt1+, SandyBridge events, 16-deep LBR, full-width counters, Intel PMU driver.
  355. Oct 27 20:18:09 localhost kernel: [ 0.031435] ... version: 3
  356. Oct 27 20:18:09 localhost kernel: [ 0.031435] ... bit width: 48
  357. Oct 27 20:18:09 localhost kernel: [ 0.031436] ... generic registers: 8
  358. Oct 27 20:18:09 localhost kernel: [ 0.031437] ... value mask: 0000ffffffffffff
  359. Oct 27 20:18:09 localhost kernel: [ 0.031437] ... max period: 00007fffffffffff
  360. Oct 27 20:18:09 localhost kernel: [ 0.031438] ... fixed-purpose events: 3
  361. Oct 27 20:18:09 localhost kernel: [ 0.031438] ... event mask: 00000007000000ff
  362. Oct 27 20:18:09 localhost kernel: [ 0.031482] Hierarchical SRCU implementation.
  363. Oct 27 20:18:09 localhost kernel: [ 0.032000] NMI watchdog: Enabled. Permanently consumes one hw-PMU counter.
  364. Oct 27 20:18:09 localhost kernel: [ 0.032000] smp: Bringing up secondary CPUs ...
  365. Oct 27 20:18:09 localhost kernel: [ 0.032000] x86: Booting SMP configuration:
  366. Oct 27 20:18:09 localhost kernel: [ 0.032000] .... node #0, CPUs: #1
  367. Oct 27 20:18:09 localhost kernel: [ 0.032028] smp: Brought up 1 node, 2 CPUs
  368. Oct 27 20:18:09 localhost kernel: [ 0.032028] smpboot: Max logical packages: 1
  369. Oct 27 20:18:09 localhost kernel: [ 0.032028] smpboot: Total of 2 processors activated (9578.13 BogoMIPS)
  370. Oct 27 20:18:09 localhost kernel: [ 0.033215] devtmpfs: initialized
  371. Oct 27 20:18:09 localhost kernel: [ 0.033215] x86/mm: Memory block size: 128MB
  372. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.selinux
  373. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64
  374. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64EXEC
  375. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64TRANSMUTE
  376. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.SMACK64MMAP
  377. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.apparmor
  378. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.ima
  379. Oct 27 20:18:09 localhost kernel: [ 0.033215] evm: security.capability
  380. Oct 27 20:18:09 localhost kernel: [ 0.033215] PM: Registering ACPI NVS region [mem 0xdf590000-0xdf5d5fff] (286720 bytes)
  381. Oct 27 20:18:09 localhost kernel: [ 0.033215] PM: Registering ACPI NVS region [mem 0xdf60d000-0xdf615fff] (36864 bytes)
  382. Oct 27 20:18:09 localhost kernel: [ 0.033215] PM: Registering ACPI NVS region [mem 0xdf63e000-0xdf680fff] (274432 bytes)
  383. Oct 27 20:18:09 localhost kernel: [ 0.033215] clocksource: jiffies: mask: 0xffffffff max_cycles: 0xffffffff, max_idle_ns: 7645041785100000 ns
  384. Oct 27 20:18:09 localhost kernel: [ 0.033215] futex hash table entries: 512 (order: 3, 32768 bytes)
  385. Oct 27 20:18:09 localhost kernel: [ 0.033215] pinctrl core: initialized pinctrl subsystem
  386. Oct 27 20:18:09 localhost kernel: [ 0.033215] RTC time: 19:18:01, date: 10/27/19
  387. Oct 27 20:18:09 localhost kernel: [ 0.033215] NET: Registered protocol family 16
  388. Oct 27 20:18:09 localhost kernel: [ 0.033215] audit: initializing netlink subsys (disabled)
  389. Oct 27 20:18:09 localhost kernel: [ 0.033215] audit: type=2000 audit(1572203881.032:1): state=initialized audit_enabled=0 res=1
  390. Oct 27 20:18:09 localhost kernel: [ 0.033215] cpuidle: using governor ladder
  391. Oct 27 20:18:09 localhost kernel: [ 0.033215] cpuidle: using governor menu
  392. Oct 27 20:18:09 localhost kernel: [ 0.033215] ACPI: bus type PCI registered
  393. Oct 27 20:18:09 localhost kernel: [ 0.033215] acpiphp: ACPI Hot Plug PCI Controller Driver version: 0.5
  394. Oct 27 20:18:09 localhost kernel: [ 0.033215] PCI: MMCONFIG for domain 0000 [bus 00-ff] at [mem 0xe0000000-0xefffffff] (base 0xe0000000)
  395. Oct 27 20:18:09 localhost kernel: [ 0.033215] PCI: not using MMCONFIG
  396. Oct 27 20:18:09 localhost kernel: [ 0.033215] PCI: Using configuration type 1 for base access
  397. Oct 27 20:18:09 localhost kernel: [ 0.033215] core: PMU erratum BJ122, BV98, HSD29 workaround disabled, HT off
  398. Oct 27 20:18:09 localhost kernel: [ 0.033232] HugeTLB registered 2.00 MiB page size, pre-allocated 0 pages
  399. Oct 27 20:18:09 localhost kernel: [ 0.036082] ACPI: Added _OSI(Module Device)
  400. Oct 27 20:18:09 localhost kernel: [ 0.036083] ACPI: Added _OSI(Processor Device)
  401. Oct 27 20:18:09 localhost kernel: [ 0.036084] ACPI: Added _OSI(3.0 _SCP Extensions)
  402. Oct 27 20:18:09 localhost kernel: [ 0.036084] ACPI: Added _OSI(Processor Aggregator Device)
  403. Oct 27 20:18:09 localhost kernel: [ 0.036086] ACPI: Added _OSI(Linux-Dell-Video)
  404. Oct 27 20:18:09 localhost kernel: [ 0.036087] ACPI: Added _OSI(Linux-Lenovo-NV-HDMI-Audio)
  405. Oct 27 20:18:09 localhost kernel: [ 0.036087] ACPI: Added _OSI(Linux-HPI-Hybrid-Graphics)
  406. Oct 27 20:18:09 localhost kernel: [ 0.036296] ACPI: Executed 1 blocks of module-level executable AML code
  407. Oct 27 20:18:09 localhost kernel: [ 0.041863] ACPI: Dynamic OEM Table Load:
  408. Oct 27 20:18:09 localhost kernel: [ 0.041868] ACPI: SSDT 0xFFFF9E6BD9DA3C00 0001D8 (v01 AMI IST 00000001 MSFT 03000001)
  409. Oct 27 20:18:09 localhost kernel: [ 0.042080] ACPI: Dynamic OEM Table Load:
  410. Oct 27 20:18:09 localhost kernel: [ 0.042083] ACPI: SSDT 0xFFFF9E6BD9D4FA80 000054 (v01 AMI CST 00000001 MSFT 03000001)
  411. Oct 27 20:18:09 localhost kernel: [ 0.043060] ACPI: Interpreter enabled
  412. Oct 27 20:18:09 localhost kernel: [ 0.043079] ACPI: (supports S0 S1 S3 S4 S5)
  413. Oct 27 20:18:09 localhost kernel: [ 0.043080] ACPI: Using IOAPIC for interrupt routing
  414. Oct 27 20:18:09 localhost kernel: [ 0.043115] PCI: MMCONFIG for domain 0000 [bus 00-ff] at [mem 0xe0000000-0xefffffff] (base 0xe0000000)
  415. Oct 27 20:18:09 localhost kernel: [ 0.043219] PCI: MMCONFIG at [mem 0xe0000000-0xefffffff] reserved in ACPI motherboard resources
  416. Oct 27 20:18:09 localhost kernel: [ 0.043234] PCI: Using host bridge windows from ACPI; if necessary, use "pci=nocrs" and report a bug
  417. Oct 27 20:18:09 localhost kernel: [ 0.043662] ACPI: GPE 0x1B active on init
  418. Oct 27 20:18:09 localhost kernel: [ 0.043677] ACPI: Enabled 8 GPEs in block 00 to 3F
  419. Oct 27 20:18:09 localhost kernel: [ 0.043939] ACPI: [Firmware Bug]: BIOS _OSI(Linux) query ignored
  420. Oct 27 20:18:09 localhost kernel: [ 0.053280] ACPI: PCI Root Bridge [PCI0] (domain 0000 [bus 00-ff])
  421. Oct 27 20:18:09 localhost kernel: [ 0.053285] acpi PNP0A08:00: _OSC: OS supports [ExtendedConfig ASPM ClockPM Segments MSI]
  422. Oct 27 20:18:09 localhost kernel: [ 0.053528] acpi PNP0A08:00: _OSC: platform does not support [PCIeHotplug]
  423. Oct 27 20:18:09 localhost kernel: [ 0.053755] acpi PNP0A08:00: _OSC: OS now controls [PME AER PCIeCapability]
  424. Oct 27 20:18:09 localhost kernel: [ 0.054170] PCI host bridge to bus 0000:00
  425. Oct 27 20:18:09 localhost kernel: [ 0.054173] pci_bus 0000:00: root bus resource [io 0x0000-0x03af window]
  426. Oct 27 20:18:09 localhost kernel: [ 0.054174] pci_bus 0000:00: root bus resource [io 0x03e0-0x0cf7 window]
  427. Oct 27 20:18:09 localhost kernel: [ 0.054175] pci_bus 0000:00: root bus resource [io 0x03b0-0x03df window]
  428. Oct 27 20:18:09 localhost kernel: [ 0.054176] pci_bus 0000:00: root bus resource [io 0x0d00-0xffff window]
  429. Oct 27 20:18:09 localhost kernel: [ 0.054178] pci_bus 0000:00: root bus resource [mem 0x000a0000-0x000bffff window]
  430. Oct 27 20:18:09 localhost kernel: [ 0.054179] pci_bus 0000:00: root bus resource [mem 0x000c0000-0x000dffff window]
  431. Oct 27 20:18:09 localhost kernel: [ 0.054180] pci_bus 0000:00: root bus resource [mem 0xf0000000-0xffffffff window]
  432. Oct 27 20:18:09 localhost kernel: [ 0.054181] pci_bus 0000:00: root bus resource [bus 00-ff]
  433. Oct 27 20:18:09 localhost kernel: [ 0.054189] pci 0000:00:00.0: [8086:0100] type 00 class 0x060000
  434. Oct 27 20:18:09 localhost kernel: [ 0.054291] pci 0000:00:01.0: [8086:0101] type 01 class 0x060400
  435. Oct 27 20:18:09 localhost kernel: [ 0.054328] pci 0000:00:01.0: PME# supported from D0 D3hot D3cold
  436. Oct 27 20:18:09 localhost kernel: [ 0.054459] pci 0000:00:16.0: [8086:1c3a] type 00 class 0x078000
  437. Oct 27 20:18:09 localhost kernel: [ 0.054496] pci 0000:00:16.0: reg 0x10: [mem 0xfb308000-0xfb30800f 64bit]
  438. Oct 27 20:18:09 localhost kernel: [ 0.054604] pci 0000:00:16.0: PME# supported from D0 D3hot D3cold
  439. Oct 27 20:18:09 localhost kernel: [ 0.054707] pci 0000:00:1a.0: [8086:1c2d] type 00 class 0x0c0320
  440. Oct 27 20:18:09 localhost kernel: [ 0.054739] pci 0000:00:1a.0: reg 0x10: [mem 0xfb307000-0xfb3073ff]
  441. Oct 27 20:18:09 localhost kernel: [ 0.054864] pci 0000:00:1a.0: PME# supported from D0 D3hot D3cold
  442. Oct 27 20:18:09 localhost kernel: [ 0.054958] pci 0000:00:1b.0: [8086:1c20] type 00 class 0x040300
  443. Oct 27 20:18:09 localhost kernel: [ 0.054990] pci 0000:00:1b.0: reg 0x10: [mem 0xfb300000-0xfb303fff 64bit]
  444. Oct 27 20:18:09 localhost kernel: [ 0.055104] pci 0000:00:1b.0: PME# supported from D0 D3hot D3cold
  445. Oct 27 20:18:09 localhost kernel: [ 0.055199] pci 0000:00:1c.0: [8086:1c10] type 01 class 0x060400
  446. Oct 27 20:18:09 localhost kernel: [ 0.055325] pci 0000:00:1c.0: PME# supported from D0 D3hot D3cold
  447. Oct 27 20:18:09 localhost kernel: [ 0.055428] pci 0000:00:1c.1: [8086:244e] type 01 class 0x060401
  448. Oct 27 20:18:09 localhost kernel: [ 0.055554] pci 0000:00:1c.1: PME# supported from D0 D3hot D3cold
  449. Oct 27 20:18:09 localhost kernel: [ 0.055654] pci 0000:00:1c.2: [8086:1c14] type 01 class 0x060400
  450. Oct 27 20:18:09 localhost kernel: [ 0.055779] pci 0000:00:1c.2: PME# supported from D0 D3hot D3cold
  451. Oct 27 20:18:09 localhost kernel: [ 0.055887] pci 0000:00:1d.0: [8086:1c26] type 00 class 0x0c0320
  452. Oct 27 20:18:09 localhost kernel: [ 0.055918] pci 0000:00:1d.0: reg 0x10: [mem 0xfb306000-0xfb3063ff]
  453. Oct 27 20:18:09 localhost kernel: [ 0.056044] pci 0000:00:1d.0: PME# supported from D0 D3hot D3cold
  454. Oct 27 20:18:09 localhost kernel: [ 0.056137] pci 0000:00:1f.0: [8086:1c5c] type 00 class 0x060100
  455. Oct 27 20:18:09 localhost kernel: [ 0.056374] pci 0000:00:1f.2: [8086:1c02] type 00 class 0x010601
  456. Oct 27 20:18:09 localhost kernel: [ 0.056403] pci 0000:00:1f.2: reg 0x10: [io 0xf070-0xf077]
  457. Oct 27 20:18:09 localhost kernel: [ 0.056414] pci 0000:00:1f.2: reg 0x14: [io 0xf060-0xf063]
  458. Oct 27 20:18:09 localhost kernel: [ 0.056425] pci 0000:00:1f.2: reg 0x18: [io 0xf050-0xf057]
  459. Oct 27 20:18:09 localhost kernel: [ 0.056437] pci 0000:00:1f.2: reg 0x1c: [io 0xf040-0xf043]
  460. Oct 27 20:18:09 localhost kernel: [ 0.056447] pci 0000:00:1f.2: reg 0x20: [io 0xf020-0xf03f]
  461. Oct 27 20:18:09 localhost kernel: [ 0.056458] pci 0000:00:1f.2: reg 0x24: [mem 0xfb305000-0xfb3057ff]
  462. Oct 27 20:18:09 localhost kernel: [ 0.056524] pci 0000:00:1f.2: PME# supported from D3hot
  463. Oct 27 20:18:09 localhost kernel: [ 0.056609] pci 0000:00:1f.3: [8086:1c22] type 00 class 0x0c0500
  464. Oct 27 20:18:09 localhost kernel: [ 0.056637] pci 0000:00:1f.3: reg 0x10: [mem 0xfb304000-0xfb3040ff 64bit]
  465. Oct 27 20:18:09 localhost kernel: [ 0.056669] pci 0000:00:1f.3: reg 0x20: [io 0xf000-0xf01f]
  466. Oct 27 20:18:09 localhost kernel: [ 0.056808] pci 0000:01:00.0: [10de:1040] type 00 class 0x030000
  467. Oct 27 20:18:09 localhost kernel: [ 0.056823] pci 0000:01:00.0: reg 0x10: [mem 0xfa000000-0xfaffffff]
  468. Oct 27 20:18:09 localhost kernel: [ 0.056832] pci 0000:01:00.0: reg 0x14: [mem 0xf0000000-0xf7ffffff 64bit pref]
  469. Oct 27 20:18:09 localhost kernel: [ 0.056841] pci 0000:01:00.0: reg 0x1c: [mem 0xf8000000-0xf9ffffff 64bit pref]
  470. Oct 27 20:18:09 localhost kernel: [ 0.056847] pci 0000:01:00.0: reg 0x24: [io 0xe000-0xe07f]
  471. Oct 27 20:18:09 localhost kernel: [ 0.056853] pci 0000:01:00.0: reg 0x30: [mem 0xfb000000-0xfb07ffff pref]
  472. Oct 27 20:18:09 localhost kernel: [ 0.056859] pci 0000:01:00.0: enabling Extended Tags
  473. Oct 27 20:18:09 localhost kernel: [ 0.056936] pci 0000:01:00.1: [10de:0e08] type 00 class 0x040300
  474. Oct 27 20:18:09 localhost kernel: [ 0.056949] pci 0000:01:00.1: reg 0x10: [mem 0xfb080000-0xfb083fff]
  475. Oct 27 20:18:09 localhost kernel: [ 0.056983] pci 0000:01:00.1: enabling Extended Tags
  476. Oct 27 20:18:09 localhost kernel: [ 0.057056] pci 0000:00:01.0: PCI bridge to [bus 01]
  477. Oct 27 20:18:09 localhost kernel: [ 0.057059] pci 0000:00:01.0: bridge window [io 0xe000-0xefff]
  478. Oct 27 20:18:09 localhost kernel: [ 0.057061] pci 0000:00:01.0: bridge window [mem 0xfa000000-0xfb0fffff]
  479. Oct 27 20:18:09 localhost kernel: [ 0.057063] pci 0000:00:01.0: bridge window [mem 0xf0000000-0xf9ffffff 64bit pref]
  480. Oct 27 20:18:09 localhost kernel: [ 0.057117] pci 0000:00:1c.0: PCI bridge to [bus 02]
  481. Oct 27 20:18:09 localhost kernel: [ 0.057214] pci 0000:03:00.0: [1b21:1080] type 01 class 0x060401
  482. Oct 27 20:18:09 localhost kernel: [ 0.057402] pci 0000:00:1c.1: PCI bridge to [bus 03-04] (subtractive decode)
  483. Oct 27 20:18:09 localhost kernel: [ 0.057410] pci 0000:00:1c.1: bridge window [mem 0xfb200000-0xfb2fffff]
  484. Oct 27 20:18:09 localhost kernel: [ 0.057417] pci 0000:00:1c.1: bridge window [io 0x0000-0x03af window] (subtractive decode)
  485. Oct 27 20:18:09 localhost kernel: [ 0.057419] pci 0000:00:1c.1: bridge window [io 0x03e0-0x0cf7 window] (subtractive decode)
  486. Oct 27 20:18:09 localhost kernel: [ 0.057420] pci 0000:00:1c.1: bridge window [io 0x03b0-0x03df window] (subtractive decode)
  487. Oct 27 20:18:09 localhost kernel: [ 0.057421] pci 0000:00:1c.1: bridge window [io 0x0d00-0xffff window] (subtractive decode)
  488. Oct 27 20:18:09 localhost kernel: [ 0.057422] pci 0000:00:1c.1: bridge window [mem 0x000a0000-0x000bffff window] (subtractive decode)
  489. Oct 27 20:18:09 localhost kernel: [ 0.057423] pci 0000:00:1c.1: bridge window [mem 0x000c0000-0x000dffff window] (subtractive decode)
  490. Oct 27 20:18:09 localhost kernel: [ 0.057425] pci 0000:00:1c.1: bridge window [mem 0xf0000000-0xffffffff window] (subtractive decode)
  491. Oct 27 20:18:09 localhost kernel: [ 0.057481] pci 0000:04:00.0: [1131:7146] type 00 class 0x048000
  492. Oct 27 20:18:09 localhost kernel: [ 0.057522] pci 0000:04:00.0: reg 0x10: [mem 0xfb201000-0xfb2011ff]
  493. Oct 27 20:18:09 localhost kernel: [ 0.057704] pci 0000:04:01.0: [1131:7146] type 00 class 0x048000
  494. Oct 27 20:18:09 localhost kernel: [ 0.057744] pci 0000:04:01.0: reg 0x10: [mem 0xfb200000-0xfb2001ff]
  495. Oct 27 20:18:09 localhost kernel: [ 0.057998] pci 0000:03:00.0: PCI bridge to [bus 04] (subtractive decode)
  496. Oct 27 20:18:09 localhost kernel: [ 0.058015] pci 0000:03:00.0: bridge window [mem 0xfb200000-0xfb2fffff]
  497. Oct 27 20:18:09 localhost kernel: [ 0.058027] pci 0000:03:00.0: bridge window [mem 0xfb200000-0xfb2fffff] (subtractive decode)
  498. Oct 27 20:18:09 localhost kernel: [ 0.058028] pci 0000:03:00.0: bridge window [io 0x0000-0x03af window] (subtractive decode)
  499. Oct 27 20:18:09 localhost kernel: [ 0.058029] pci 0000:03:00.0: bridge window [io 0x03e0-0x0cf7 window] (subtractive decode)
  500. Oct 27 20:18:09 localhost kernel: [ 0.058030] pci 0000:03:00.0: bridge window [io 0x03b0-0x03df window] (subtractive decode)
  501. Oct 27 20:18:09 localhost kernel: [ 0.058031] pci 0000:03:00.0: bridge window [io 0x0d00-0xffff window] (subtractive decode)
  502. Oct 27 20:18:09 localhost kernel: [ 0.058033] pci 0000:03:00.0: bridge window [mem 0x000a0000-0x000bffff window] (subtractive decode)
  503. Oct 27 20:18:09 localhost kernel: [ 0.058034] pci 0000:03:00.0: bridge window [mem 0x000c0000-0x000dffff window] (subtractive decode)
  504. Oct 27 20:18:09 localhost kernel: [ 0.058035] pci 0000:03:00.0: bridge window [mem 0xf0000000-0xffffffff window] (subtractive decode)
  505. Oct 27 20:18:09 localhost kernel: [ 0.058125] pci 0000:05:00.0: [1969:1083] type 00 class 0x020000
  506. Oct 27 20:18:09 localhost kernel: [ 0.058178] pci 0000:05:00.0: reg 0x10: [mem 0xfb100000-0xfb13ffff 64bit]
  507. Oct 27 20:18:09 localhost kernel: [ 0.058196] pci 0000:05:00.0: reg 0x18: [io 0xd000-0xd07f]
  508. Oct 27 20:18:09 localhost kernel: [ 0.058372] pci 0000:05:00.0: PME# supported from D0 D1 D2 D3hot D3cold
  509. Oct 27 20:18:09 localhost kernel: [ 0.068032] pci 0000:00:1c.2: PCI bridge to [bus 05]
  510. Oct 27 20:18:09 localhost kernel: [ 0.068037] pci 0000:00:1c.2: bridge window [io 0xd000-0xdfff]
  511. Oct 27 20:18:09 localhost kernel: [ 0.068042] pci 0000:00:1c.2: bridge window [mem 0xfb100000-0xfb1fffff]
  512. Oct 27 20:18:09 localhost kernel: [ 0.069034] ACPI: PCI Interrupt Link [LNKA] (IRQs 3 4 5 6 7 10 *11 12 14 15)
  513. Oct 27 20:18:09 localhost kernel: [ 0.069115] ACPI: PCI Interrupt Link [LNKB] (IRQs 3 4 5 6 7 *10 11 12 14 15)
  514. Oct 27 20:18:09 localhost kernel: [ 0.069191] ACPI: PCI Interrupt Link [LNKC] (IRQs *3 4 5 6 10 11 12 14 15)
  515. Oct 27 20:18:09 localhost kernel: [ 0.069266] ACPI: PCI Interrupt Link [LNKD] (IRQs *3 4 5 6 10 11 12 14 15)
  516. Oct 27 20:18:09 localhost kernel: [ 0.069341] ACPI: PCI Interrupt Link [LNKE] (IRQs 3 4 5 6 7 10 11 12 14 15) *0
  517. Oct 27 20:18:09 localhost kernel: [ 0.069417] ACPI: PCI Interrupt Link [LNKF] (IRQs 3 4 5 6 7 10 11 12 14 15) *0
  518. Oct 27 20:18:09 localhost kernel: [ 0.069492] ACPI: PCI Interrupt Link [LNKG] (IRQs *3 4 5 6 7 10 11 12 14 15)
  519. Oct 27 20:18:09 localhost kernel: [ 0.069568] ACPI: PCI Interrupt Link [LNKH] (IRQs *3 4 5 6 7 10 11 12 14 15)
  520. Oct 27 20:18:09 localhost kernel: [ 0.069871] SCSI subsystem initialized
  521. Oct 27 20:18:09 localhost kernel: [ 0.069910] libata version 3.00 loaded.
  522. Oct 27 20:18:09 localhost kernel: [ 0.069910] pci 0000:01:00.0: vgaarb: setting as boot VGA device
  523. Oct 27 20:18:09 localhost kernel: [ 0.069910] pci 0000:01:00.0: vgaarb: VGA device added: decodes=io+mem,owns=io+mem,locks=none
  524. Oct 27 20:18:09 localhost kernel: [ 0.069910] pci 0000:01:00.0: vgaarb: bridge control possible
  525. Oct 27 20:18:09 localhost kernel: [ 0.069910] vgaarb: loaded
  526. Oct 27 20:18:09 localhost kernel: [ 0.069910] ACPI: bus type USB registered
  527. Oct 27 20:18:09 localhost kernel: [ 0.069910] usbcore: registered new interface driver usbfs
  528. Oct 27 20:18:09 localhost kernel: [ 0.069910] usbcore: registered new interface driver hub
  529. Oct 27 20:18:09 localhost kernel: [ 0.069910] usbcore: registered new device driver usb
  530. Oct 27 20:18:09 localhost kernel: [ 0.069910] EDAC MC: Ver: 3.0.0
  531. Oct 27 20:18:09 localhost kernel: [ 0.069910] PCI: Using ACPI for IRQ routing
  532. Oct 27 20:18:09 localhost kernel: [ 0.081129] PCI: pci_cache_line_size set to 64 bytes
  533. Oct 27 20:18:09 localhost kernel: [ 0.081196] e820: reserve RAM buffer [mem 0x0009d800-0x0009ffff]
  534. Oct 27 20:18:09 localhost kernel: [ 0.081197] e820: reserve RAM buffer [mem 0xdf590000-0xdfffffff]
  535. Oct 27 20:18:09 localhost kernel: [ 0.081199] e820: reserve RAM buffer [mem 0xdf60c000-0xdfffffff]
  536. Oct 27 20:18:09 localhost kernel: [ 0.081200] e820: reserve RAM buffer [mem 0xdf800000-0xdfffffff]
  537. Oct 27 20:18:09 localhost kernel: [ 0.081201] e820: reserve RAM buffer [mem 0x11f800000-0x11fffffff]
  538. Oct 27 20:18:09 localhost kernel: [ 0.081295] NetLabel: Initializing
  539. Oct 27 20:18:09 localhost kernel: [ 0.081296] NetLabel: domain hash size = 128
  540. Oct 27 20:18:09 localhost kernel: [ 0.081297] NetLabel: protocols = UNLABELED CIPSOv4 CALIPSO
  541. Oct 27 20:18:09 localhost kernel: [ 0.081314] NetLabel: unlabeled traffic allowed by default
  542. Oct 27 20:18:09 localhost kernel: [ 0.081330] hpet0: at MMIO 0xfed00000, IRQs 2, 8, 0, 0, 0, 0, 0, 0
  543. Oct 27 20:18:09 localhost kernel: [ 0.081330] hpet0: 8 comparators, 64-bit 14.318180 MHz counter
  544. Oct 27 20:18:09 localhost kernel: [ 0.082599] clocksource: Switched to clocksource hpet
  545. Oct 27 20:18:09 localhost kernel: [ 0.091757] VFS: Disk quotas dquot_6.6.0
  546. Oct 27 20:18:09 localhost kernel: [ 0.091775] VFS: Dquot-cache hash table entries: 512 (order 0, 4096 bytes)
  547. Oct 27 20:18:09 localhost kernel: [ 0.091877] AppArmor: AppArmor Filesystem Enabled
  548. Oct 27 20:18:09 localhost kernel: [ 0.091907] pnp: PnP ACPI init
  549. Oct 27 20:18:09 localhost kernel: [ 0.092134] system 00:00: [mem 0xfed10000-0xfed19fff] has been reserved
  550. Oct 27 20:18:09 localhost kernel: [ 0.092135] system 00:00: [mem 0xe0000000-0xefffffff] has been reserved
  551. Oct 27 20:18:09 localhost kernel: [ 0.092137] system 00:00: [mem 0xfed90000-0xfed93fff] has been reserved
  552. Oct 27 20:18:09 localhost kernel: [ 0.092138] system 00:00: [mem 0xfed20000-0xfed3ffff] has been reserved
  553. Oct 27 20:18:09 localhost kernel: [ 0.092139] system 00:00: [mem 0xfee00000-0xfee0ffff] has been reserved
  554. Oct 27 20:18:09 localhost kernel: [ 0.092145] system 00:00: Plug and Play ACPI device, IDs PNP0c01 (active)
  555. Oct 27 20:18:09 localhost kernel: [ 0.092264] system 00:01: [io 0x0290-0x029f] has been reserved
  556. Oct 27 20:18:09 localhost kernel: [ 0.092268] system 00:01: Plug and Play ACPI device, IDs PNP0c02 (active)
  557. Oct 27 20:18:09 localhost kernel: [ 0.092723] pnp 00:02: [dma 3]
  558. Oct 27 20:18:09 localhost kernel: [ 0.092867] pnp 00:02: Plug and Play ACPI device, IDs PNP0401 (active)
  559. Oct 27 20:18:09 localhost kernel: [ 0.093005] pnp 00:03: Plug and Play ACPI device, IDs NTN0530 (active)
  560. Oct 27 20:18:09 localhost kernel: [ 0.093032] pnp 00:04: Plug and Play ACPI device, IDs PNP0b00 (active)
  561. Oct 27 20:18:09 localhost kernel: [ 0.093098] system 00:05: [io 0x04d0-0x04d1] has been reserved
  562. Oct 27 20:18:09 localhost kernel: [ 0.093103] system 00:05: Plug and Play ACPI device, IDs PNP0c02 (active)
  563. Oct 27 20:18:09 localhost kernel: [ 0.093428] pnp 00:06: [dma 0 disabled]
  564. Oct 27 20:18:09 localhost kernel: [ 0.093476] pnp 00:06: Plug and Play ACPI device, IDs PNP0501 (active)
  565. Oct 27 20:18:09 localhost kernel: [ 0.093901] system 00:07: [io 0x0400-0x0453] has been reserved
  566. Oct 27 20:18:09 localhost kernel: [ 0.093903] system 00:07: [io 0x0458-0x047f] has been reserved
  567. Oct 27 20:18:09 localhost kernel: [ 0.093905] system 00:07: [io 0x1180-0x119f] has been reserved
  568. Oct 27 20:18:09 localhost kernel: [ 0.093906] system 00:07: [io 0x0500-0x057f] has been reserved
  569. Oct 27 20:18:09 localhost kernel: [ 0.093908] system 00:07: [mem 0xfed1c000-0xfed1ffff] has been reserved
  570. Oct 27 20:18:09 localhost kernel: [ 0.093910] system 00:07: [mem 0xfec00000-0xfecfffff] could not be reserved
  571. Oct 27 20:18:09 localhost kernel: [ 0.093911] system 00:07: [mem 0xfed08000-0xfed08fff] has been reserved
  572. Oct 27 20:18:09 localhost kernel: [ 0.093913] system 00:07: [mem 0xff000000-0xffffffff] has been reserved
  573. Oct 27 20:18:09 localhost kernel: [ 0.093917] system 00:07: Plug and Play ACPI device, IDs PNP0c01 (active)
  574. Oct 27 20:18:09 localhost kernel: [ 0.093998] system 00:08: [io 0x0454-0x0457] has been reserved
  575. Oct 27 20:18:09 localhost kernel: [ 0.094002] system 00:08: Plug and Play ACPI device, IDs INT3f0d PNP0c02 (active)
  576. Oct 27 20:18:09 localhost kernel: [ 0.094291] pnp: PnP ACPI: found 9 devices
  577. Oct 27 20:18:09 localhost kernel: [ 0.100766] clocksource: acpi_pm: mask: 0xffffff max_cycles: 0xffffff, max_idle_ns: 2085701024 ns
  578. Oct 27 20:18:09 localhost kernel: [ 0.100826] pci 0000:00:01.0: PCI bridge to [bus 01]
  579. Oct 27 20:18:09 localhost kernel: [ 0.100828] pci 0000:00:01.0: bridge window [io 0xe000-0xefff]
  580. Oct 27 20:18:09 localhost kernel: [ 0.100831] pci 0000:00:01.0: bridge window [mem 0xfa000000-0xfb0fffff]
  581. Oct 27 20:18:09 localhost kernel: [ 0.100833] pci 0000:00:01.0: bridge window [mem 0xf0000000-0xf9ffffff 64bit pref]
  582. Oct 27 20:18:09 localhost kernel: [ 0.100836] pci 0000:00:1c.0: PCI bridge to [bus 02]
  583. Oct 27 20:18:09 localhost kernel: [ 0.100852] pci 0000:03:00.0: PCI bridge to [bus 04]
  584. Oct 27 20:18:09 localhost kernel: [ 0.100860] pci 0000:03:00.0: bridge window [mem 0xfb200000-0xfb2fffff]
  585. Oct 27 20:18:09 localhost kernel: [ 0.100877] pci 0000:00:1c.1: PCI bridge to [bus 03-04]
  586. Oct 27 20:18:09 localhost kernel: [ 0.100883] pci 0000:00:1c.1: bridge window [mem 0xfb200000-0xfb2fffff]
  587. Oct 27 20:18:09 localhost kernel: [ 0.100894] pci 0000:00:1c.2: PCI bridge to [bus 05]
  588. Oct 27 20:18:09 localhost kernel: [ 0.100896] pci 0000:00:1c.2: bridge window [io 0xd000-0xdfff]
  589. Oct 27 20:18:09 localhost kernel: [ 0.100902] pci 0000:00:1c.2: bridge window [mem 0xfb100000-0xfb1fffff]
  590. Oct 27 20:18:09 localhost kernel: [ 0.100914] pci_bus 0000:00: resource 4 [io 0x0000-0x03af window]
  591. Oct 27 20:18:09 localhost kernel: [ 0.100915] pci_bus 0000:00: resource 5 [io 0x03e0-0x0cf7 window]
  592. Oct 27 20:18:09 localhost kernel: [ 0.100916] pci_bus 0000:00: resource 6 [io 0x03b0-0x03df window]
  593. Oct 27 20:18:09 localhost kernel: [ 0.100917] pci_bus 0000:00: resource 7 [io 0x0d00-0xffff window]
  594. Oct 27 20:18:09 localhost kernel: [ 0.100919] pci_bus 0000:00: resource 8 [mem 0x000a0000-0x000bffff window]
  595. Oct 27 20:18:09 localhost kernel: [ 0.100920] pci_bus 0000:00: resource 9 [mem 0x000c0000-0x000dffff window]
  596. Oct 27 20:18:09 localhost kernel: [ 0.100921] pci_bus 0000:00: resource 10 [mem 0xf0000000-0xffffffff window]
  597. Oct 27 20:18:09 localhost kernel: [ 0.100922] pci_bus 0000:01: resource 0 [io 0xe000-0xefff]
  598. Oct 27 20:18:09 localhost kernel: [ 0.100924] pci_bus 0000:01: resource 1 [mem 0xfa000000-0xfb0fffff]
  599. Oct 27 20:18:09 localhost kernel: [ 0.100925] pci_bus 0000:01: resource 2 [mem 0xf0000000-0xf9ffffff 64bit pref]
  600. Oct 27 20:18:09 localhost kernel: [ 0.100926] pci_bus 0000:03: resource 1 [mem 0xfb200000-0xfb2fffff]
  601. Oct 27 20:18:09 localhost kernel: [ 0.100927] pci_bus 0000:03: resource 4 [io 0x0000-0x03af window]
  602. Oct 27 20:18:09 localhost kernel: [ 0.100929] pci_bus 0000:03: resource 5 [io 0x03e0-0x0cf7 window]
  603. Oct 27 20:18:09 localhost kernel: [ 0.100930] pci_bus 0000:03: resource 6 [io 0x03b0-0x03df window]
  604. Oct 27 20:18:09 localhost kernel: [ 0.100931] pci_bus 0000:03: resource 7 [io 0x0d00-0xffff window]
  605. Oct 27 20:18:09 localhost kernel: [ 0.100932] pci_bus 0000:03: resource 8 [mem 0x000a0000-0x000bffff window]
  606. Oct 27 20:18:09 localhost kernel: [ 0.100933] pci_bus 0000:03: resource 9 [mem 0x000c0000-0x000dffff window]
  607. Oct 27 20:18:09 localhost kernel: [ 0.100934] pci_bus 0000:03: resource 10 [mem 0xf0000000-0xffffffff window]
  608. Oct 27 20:18:09 localhost kernel: [ 0.100936] pci_bus 0000:04: resource 1 [mem 0xfb200000-0xfb2fffff]
  609. Oct 27 20:18:09 localhost kernel: [ 0.100937] pci_bus 0000:04: resource 4 [mem 0xfb200000-0xfb2fffff]
  610. Oct 27 20:18:09 localhost kernel: [ 0.100938] pci_bus 0000:04: resource 5 [io 0x0000-0x03af window]
  611. Oct 27 20:18:09 localhost kernel: [ 0.100939] pci_bus 0000:04: resource 6 [io 0x03e0-0x0cf7 window]
  612. Oct 27 20:18:09 localhost kernel: [ 0.100940] pci_bus 0000:04: resource 7 [io 0x03b0-0x03df window]
  613. Oct 27 20:18:09 localhost kernel: [ 0.100941] pci_bus 0000:04: resource 8 [io 0x0d00-0xffff window]
  614. Oct 27 20:18:09 localhost kernel: [ 0.100942] pci_bus 0000:04: resource 9 [mem 0x000a0000-0x000bffff window]
  615. Oct 27 20:18:09 localhost kernel: [ 0.100944] pci_bus 0000:04: resource 10 [mem 0x000c0000-0x000dffff window]
  616. Oct 27 20:18:09 localhost kernel: [ 0.100945] pci_bus 0000:04: resource 11 [mem 0xf0000000-0xffffffff window]
  617. Oct 27 20:18:09 localhost kernel: [ 0.100946] pci_bus 0000:05: resource 0 [io 0xd000-0xdfff]
  618. Oct 27 20:18:09 localhost kernel: [ 0.100947] pci_bus 0000:05: resource 1 [mem 0xfb100000-0xfb1fffff]
  619. Oct 27 20:18:09 localhost kernel: [ 0.101048] NET: Registered protocol family 2
  620. Oct 27 20:18:09 localhost kernel: [ 0.101218] TCP established hash table entries: 32768 (order: 6, 262144 bytes)
  621. Oct 27 20:18:09 localhost kernel: [ 0.101292] TCP bind hash table entries: 32768 (order: 7, 524288 bytes)
  622. Oct 27 20:18:09 localhost kernel: [ 0.101395] TCP: Hash tables configured (established 32768 bind 32768)
  623. Oct 27 20:18:09 localhost kernel: [ 0.101427] UDP hash table entries: 2048 (order: 4, 65536 bytes)
  624. Oct 27 20:18:09 localhost kernel: [ 0.101445] UDP-Lite hash table entries: 2048 (order: 4, 65536 bytes)
  625. Oct 27 20:18:09 localhost kernel: [ 0.101491] NET: Registered protocol family 1
  626. Oct 27 20:18:09 localhost kernel: [ 0.160123] pci 0000:01:00.0: Video device with shadowed ROM at [mem 0x000c0000-0x000dffff]
  627. Oct 27 20:18:09 localhost kernel: [ 0.160143] pci 0000:05:00.0: [Firmware Bug]: disabling VPD access (can't determine size of non-standard VPD format)
  628. Oct 27 20:18:09 localhost kernel: [ 0.160147] PCI: CLS 64 bytes, default 64
  629. Oct 27 20:18:09 localhost kernel: [ 0.160194] Unpacking initramfs...
  630. Oct 27 20:18:09 localhost kernel: [ 1.210361] Freeing initrd memory: 68684K
  631. Oct 27 20:18:09 localhost kernel: [ 1.210365] PCI-DMA: Using software bounce buffering for IO (SWIOTLB)
  632. Oct 27 20:18:09 localhost kernel: [ 1.210366] software IO TLB: mapped [mem 0xdb590000-0xdf590000] (64MB)
  633. Oct 27 20:18:09 localhost kernel: [ 1.210630] Scanning for low memory corruption every 60 seconds
  634. Oct 27 20:18:09 localhost kernel: [ 1.211290] Initialise system trusted keyrings
  635. Oct 27 20:18:09 localhost kernel: [ 1.211301] Key type blacklist registered
  636. Oct 27 20:18:09 localhost kernel: [ 1.211331] workingset: timestamp_bits=36 max_order=20 bucket_order=0
  637. Oct 27 20:18:09 localhost kernel: [ 1.212492] zbud: loaded
  638. Oct 27 20:18:09 localhost kernel: [ 1.212991] squashfs: version 4.0 (2009/01/31) Phillip Lougher
  639. Oct 27 20:18:09 localhost kernel: [ 1.213136] fuse init (API version 7.26)
  640. Oct 27 20:18:09 localhost kernel: [ 1.214580] Key type asymmetric registered
  641. Oct 27 20:18:09 localhost kernel: [ 1.214582] Asymmetric key parser 'x509' registered
  642. Oct 27 20:18:09 localhost kernel: [ 1.214613] Block layer SCSI generic (bsg) driver version 0.4 loaded (major 246)
  643. Oct 27 20:18:09 localhost kernel: [ 1.214644] io scheduler noop registered
  644. Oct 27 20:18:09 localhost kernel: [ 1.214645] io scheduler deadline registered
  645. Oct 27 20:18:09 localhost kernel: [ 1.214670] io scheduler cfq registered (default)
  646. Oct 27 20:18:09 localhost kernel: [ 1.215328] pcieport 0000:00:01.0: Signaling PME with IRQ 24
  647. Oct 27 20:18:09 localhost kernel: [ 1.215363] pcieport 0000:00:1c.0: Signaling PME with IRQ 25
  648. Oct 27 20:18:09 localhost kernel: [ 1.215390] pcieport 0000:00:1c.2: Signaling PME with IRQ 26
  649. Oct 27 20:18:09 localhost kernel: [ 1.215456] vesafb: mode is 640x480x32, linelength=2560, pages=0
  650. Oct 27 20:18:09 localhost kernel: [ 1.215457] vesafb: scrolling: redraw
  651. Oct 27 20:18:09 localhost kernel: [ 1.215458] vesafb: Truecolor: size=8:8:8:8, shift=24:16:8:0
  652. Oct 27 20:18:09 localhost kernel: [ 1.215470] vesafb: framebuffer at 0xf9000000, mapped to 0x (ptrval), using 1216k, total 1216k
  653. Oct 27 20:18:09 localhost kernel: [ 1.215563] Console: switching to colour frame buffer device 80x30
  654. Oct 27 20:18:09 localhost kernel: [ 1.215574] fb0: VESA VGA frame buffer device
  655. Oct 27 20:18:09 localhost kernel: [ 1.215589] intel_idle: MWAIT substates: 0x1120
  656. Oct 27 20:18:09 localhost kernel: [ 1.215590] intel_idle: v0.4.1 model 0x2A
  657. Oct 27 20:18:09 localhost kernel: [ 1.215654] intel_idle: lapic_timer_reliable_states 0xffffffff
  658. Oct 27 20:18:09 localhost kernel: [ 1.215744] input: Power Button as /devices/LNXSYSTM:00/LNXSYBUS:00/PNP0C0C:00/input/input0
  659. Oct 27 20:18:09 localhost kernel: [ 1.215753] ACPI: Power Button [PWRB]
  660. Oct 27 20:18:09 localhost kernel: [ 1.215788] input: Power Button as /devices/LNXSYSTM:00/LNXPWRBN:00/input/input1
  661. Oct 27 20:18:09 localhost kernel: [ 1.215816] ACPI: Power Button [PWRF]
  662. Oct 27 20:18:09 localhost kernel: [ 1.216312] Serial: 8250/16550 driver, 32 ports, IRQ sharing enabled
  663. Oct 27 20:18:09 localhost kernel: [ 1.237066] 00:06: ttyS0 at I/O 0x3f8 (irq = 4, base_baud = 115200) is a 16550A
  664. Oct 27 20:18:09 localhost kernel: [ 1.239230] Linux agpgart interface v0.103
  665. Oct 27 20:18:09 localhost kernel: [ 1.240539] loop: module loaded
  666. Oct 27 20:18:09 localhost kernel: [ 1.240717] libphy: Fixed MDIO Bus: probed
  667. Oct 27 20:18:09 localhost kernel: [ 1.240718] tun: Universal TUN/TAP device driver, 1.6
  668. Oct 27 20:18:09 localhost kernel: [ 1.240754] PPP generic driver version 2.4.2
  669. Oct 27 20:18:09 localhost kernel: [ 1.240796] ehci_hcd: USB 2.0 'Enhanced' Host Controller (EHCI) Driver
  670. Oct 27 20:18:09 localhost kernel: [ 1.240798] ehci-pci: EHCI PCI platform driver
  671. Oct 27 20:18:09 localhost kernel: [ 1.240926] ehci-pci 0000:00:1a.0: EHCI Host Controller
  672. Oct 27 20:18:09 localhost kernel: [ 1.240932] ehci-pci 0000:00:1a.0: new USB bus registered, assigned bus number 1
  673. Oct 27 20:18:09 localhost kernel: [ 1.240948] ehci-pci 0000:00:1a.0: debug port 2
  674. Oct 27 20:18:09 localhost kernel: [ 1.244873] ehci-pci 0000:00:1a.0: cache line size of 64 is not supported
  675. Oct 27 20:18:09 localhost kernel: [ 1.244887] ehci-pci 0000:00:1a.0: irq 16, io mem 0xfb307000
  676. Oct 27 20:18:09 localhost kernel: [ 1.260035] ehci-pci 0000:00:1a.0: USB 2.0 started, EHCI 1.00
  677. Oct 27 20:18:09 localhost kernel: [ 1.260102] usb usb1: New USB device found, idVendor=1d6b, idProduct=0002
  678. Oct 27 20:18:09 localhost kernel: [ 1.260103] usb usb1: New USB device strings: Mfr=3, Product=2, SerialNumber=1
  679. Oct 27 20:18:09 localhost kernel: [ 1.260104] usb usb1: Product: EHCI Host Controller
  680. Oct 27 20:18:09 localhost kernel: [ 1.260106] usb usb1: Manufacturer: Linux 4.15.0-66-generic ehci_hcd
  681. Oct 27 20:18:09 localhost kernel: [ 1.260107] usb usb1: SerialNumber: 0000:00:1a.0
  682. Oct 27 20:18:09 localhost kernel: [ 1.260295] hub 1-0:1.0: USB hub found
  683. Oct 27 20:18:09 localhost kernel: [ 1.260303] hub 1-0:1.0: 2 ports detected
  684. Oct 27 20:18:09 localhost kernel: [ 1.260518] ehci-pci 0000:00:1d.0: EHCI Host Controller
  685. Oct 27 20:18:09 localhost kernel: [ 1.260525] ehci-pci 0000:00:1d.0: new USB bus registered, assigned bus number 2
  686. Oct 27 20:18:09 localhost kernel: [ 1.260539] ehci-pci 0000:00:1d.0: debug port 2
  687. Oct 27 20:18:09 localhost kernel: [ 1.264437] ehci-pci 0000:00:1d.0: cache line size of 64 is not supported
  688. Oct 27 20:18:09 localhost kernel: [ 1.264449] ehci-pci 0000:00:1d.0: irq 23, io mem 0xfb306000
  689. Oct 27 20:18:09 localhost kernel: [ 1.280043] ehci-pci 0000:00:1d.0: USB 2.0 started, EHCI 1.00
  690. Oct 27 20:18:09 localhost kernel: [ 1.280097] usb usb2: New USB device found, idVendor=1d6b, idProduct=0002
  691. Oct 27 20:18:09 localhost kernel: [ 1.280099] usb usb2: New USB device strings: Mfr=3, Product=2, SerialNumber=1
  692. Oct 27 20:18:09 localhost kernel: [ 1.280100] usb usb2: Product: EHCI Host Controller
  693. Oct 27 20:18:09 localhost kernel: [ 1.280101] usb usb2: Manufacturer: Linux 4.15.0-66-generic ehci_hcd
  694. Oct 27 20:18:09 localhost kernel: [ 1.280102] usb usb2: SerialNumber: 0000:00:1d.0
  695. Oct 27 20:18:09 localhost kernel: [ 1.280277] hub 2-0:1.0: USB hub found
  696. Oct 27 20:18:09 localhost kernel: [ 1.280284] hub 2-0:1.0: 2 ports detected
  697. Oct 27 20:18:09 localhost kernel: [ 1.280401] ehci-platform: EHCI generic platform driver
  698. Oct 27 20:18:09 localhost kernel: [ 1.280412] ohci_hcd: USB 1.1 'Open' Host Controller (OHCI) Driver
  699. Oct 27 20:18:09 localhost kernel: [ 1.280415] ohci-pci: OHCI PCI platform driver
  700. Oct 27 20:18:09 localhost kernel: [ 1.280423] ohci-platform: OHCI generic platform driver
  701. Oct 27 20:18:09 localhost kernel: [ 1.280429] uhci_hcd: USB Universal Host Controller Interface driver
  702. Oct 27 20:18:09 localhost kernel: [ 1.280480] i8042: PNP: No PS/2 controller found.
  703. Oct 27 20:18:09 localhost kernel: [ 1.280699] mousedev: PS/2 mouse device common for all mice
  704. Oct 27 20:18:09 localhost kernel: [ 1.281024] rtc_cmos 00:04: RTC can wake from S4
  705. Oct 27 20:18:09 localhost kernel: [ 1.281191] rtc_cmos 00:04: rtc core: registered rtc_cmos as rtc0
  706. Oct 27 20:18:09 localhost kernel: [ 1.281224] rtc_cmos 00:04: alarms up to one month, y3k, 114 bytes nvram, hpet irqs
  707. Oct 27 20:18:09 localhost kernel: [ 1.281231] i2c /dev entries driver
  708. Oct 27 20:18:09 localhost kernel: [ 1.281281] device-mapper: uevent: version 1.0.3
  709. Oct 27 20:18:09 localhost kernel: [ 1.281386] device-mapper: ioctl: 4.37.0-ioctl (2017-09-20) initialised: dm-devel@redhat.com
  710. Oct 27 20:18:09 localhost kernel: [ 1.281391] intel_pstate: Intel P-state driver initializing
  711. Oct 27 20:18:09 localhost kernel: [ 1.281492] ledtrig-cpu: registered to indicate activity on CPUs
  712. Oct 27 20:18:09 localhost kernel: [ 1.281859] NET: Registered protocol family 10
  713. Oct 27 20:18:09 localhost kernel: [ 1.286441] Segment Routing with IPv6
  714. Oct 27 20:18:09 localhost kernel: [ 1.286470] NET: Registered protocol family 17
  715. Oct 27 20:18:09 localhost kernel: [ 1.286512] Key type dns_resolver registered
  716. Oct 27 20:18:09 localhost kernel: [ 1.286685] mce: Using 7 MCE banks
  717. Oct 27 20:18:09 localhost kernel: [ 1.286696] RAS: Correctable Errors collector initialized.
  718. Oct 27 20:18:09 localhost kernel: [ 1.286731] microcode: sig=0x206a7, pf=0x2, revision=0x2f
  719. Oct 27 20:18:09 localhost kernel: [ 1.286775] microcode: Microcode Update Driver: v2.2.
  720. Oct 27 20:18:09 localhost kernel: [ 1.286788] sched_clock: Marking stable (1286771196, 0)->(1269215103, 17556093)
  721. Oct 27 20:18:09 localhost kernel: [ 1.286972] registered taskstats version 1
  722. Oct 27 20:18:09 localhost kernel: [ 1.286981] Loading compiled-in X.509 certificates
  723. Oct 27 20:18:09 localhost kernel: [ 1.289980] Loaded X.509 cert 'Build time autogenerated kernel key: 01a66adcc10ca4ce7676a3458c33483b0e2b806e'
  724. Oct 27 20:18:09 localhost kernel: [ 1.290006] zswap: loaded using pool lzo/zbud
  725. Oct 27 20:18:09 localhost kernel: [ 1.293981] Key type big_key registered
  726. Oct 27 20:18:09 localhost kernel: [ 1.293986] Key type trusted registered
  727. Oct 27 20:18:09 localhost kernel: [ 1.295910] Key type encrypted registered
  728. Oct 27 20:18:09 localhost kernel: [ 1.295914] AppArmor: AppArmor sha1 policy hashing enabled
  729. Oct 27 20:18:09 localhost kernel: [ 1.295917] ima: No TPM chip found, activating TPM-bypass! (rc=-19)
  730. Oct 27 20:18:09 localhost kernel: [ 1.295922] ima: Allocated hash algorithm: sha1
  731. Oct 27 20:18:09 localhost kernel: [ 1.295939] evm: HMAC attrs: 0x1
  732. Oct 27 20:18:09 localhost kernel: [ 1.296231] Magic number: 7:342:345
  733. Oct 27 20:18:09 localhost kernel: [ 1.296256] tty tty62: hash matches
  734. Oct 27 20:18:09 localhost kernel: [ 1.296348] rtc_cmos 00:04: setting system clock to 2019-10-27 19:18:02 UTC (1572203882)
  735. Oct 27 20:18:09 localhost kernel: [ 1.296431] BIOS EDD facility v0.16 2004-Jun-25, 0 devices found
  736. Oct 27 20:18:09 localhost kernel: [ 1.296431] EDD information not available.
  737. Oct 27 20:18:09 localhost kernel: [ 1.299024] Freeing unused kernel image memory: 2436K
  738. Oct 27 20:18:09 localhost kernel: [ 1.316034] Write protecting the kernel read-only data: 20480k
  739. Oct 27 20:18:09 localhost kernel: [ 1.316710] Freeing unused kernel image memory: 2008K
  740. Oct 27 20:18:09 localhost kernel: [ 1.317144] Freeing unused kernel image memory: 1884K
  741. Oct 27 20:18:09 localhost kernel: [ 1.326504] x86/mm: Checked W+X mappings: passed, no W+X pages found.
  742. Oct 27 20:18:09 localhost kernel: [ 1.326506] x86/mm: Checking user space page tables
  743. Oct 27 20:18:09 localhost kernel: [ 1.335430] x86/mm: Checked W+X mappings: passed, no W+X pages found.
  744. Oct 27 20:18:09 localhost kernel: [ 1.432505] ipmi message handler version 39.2
  745. Oct 27 20:18:09 localhost kernel: [ 1.433864] ipmi device interface
  746. Oct 27 20:18:09 localhost kernel: [ 1.440458] ahci 0000:00:1f.2: version 3.0
  747. Oct 27 20:18:09 localhost kernel: [ 1.450781] ahci 0000:00:1f.2: AHCI 0001.0300 32 slots 4 ports 3 Gbps 0x33 impl SATA mode
  748. Oct 27 20:18:09 localhost kernel: [ 1.450784] ahci 0000:00:1f.2: flags: 64bit ncq sntf pm led clo pio slum part ems apst
  749. Oct 27 20:18:09 localhost kernel: [ 1.460450] nvidia: loading out-of-tree module taints kernel.
  750. Oct 27 20:18:09 localhost kernel: [ 1.460460] nvidia: module license 'NVIDIA' taints kernel.
  751. Oct 27 20:18:09 localhost kernel: [ 1.460461] Disabling lock debugging due to kernel taint
  752. Oct 27 20:18:09 localhost kernel: [ 1.473410] atl1c 0000:05:00.0: version 1.0.1.1-NAPI
  753. Oct 27 20:18:09 localhost kernel: [ 1.474252] nvidia: module verification failed: signature and/or required key missing - tainting kernel
  754. Oct 27 20:18:09 localhost kernel: [ 1.481614] nvidia-nvlink: Nvlink Core is being initialized, major device number 243
  755. Oct 27 20:18:09 localhost kernel: [ 1.481927] nvidia 0000:01:00.0: vgaarb: changed VGA decodes: olddecodes=io+mem,decodes=none:owns=io+mem
  756. Oct 27 20:18:09 localhost kernel: [ 1.485365] NVRM: loading NVIDIA UNIX x86_64 Kernel Module 390.116 Sun Jan 27 07:21:36 PST 2019 (using threaded interrupts)
  757. Oct 27 20:18:09 localhost kernel: [ 1.492082] scsi host0: ahci
  758. Oct 27 20:18:09 localhost kernel: [ 1.500220] scsi host1: ahci
  759. Oct 27 20:18:09 localhost kernel: [ 1.502757] scsi host2: ahci
  760. Oct 27 20:18:09 localhost kernel: [ 1.503056] scsi host3: ahci
  761. Oct 27 20:18:09 localhost kernel: [ 1.504743] nvidia-modeset: Loading NVIDIA Kernel Mode Setting Driver for UNIX platforms 390.116 Sun Jan 27 06:30:32 PST 2019
  762. Oct 27 20:18:09 localhost kernel: [ 1.505517] [drm] [nvidia-drm] [GPU ID 0x00000100] Loading driver
  763. Oct 27 20:18:09 localhost kernel: [ 1.505519] [drm] Initialized nvidia-drm 0.0.0 20160202 for 0000:01:00.0 on minor 0
  764. Oct 27 20:18:09 localhost kernel: [ 1.509517] atl1c 0000:05:00.0 enp5s0: renamed from eth0
  765. Oct 27 20:18:09 localhost kernel: [ 1.510410] scsi host4: ahci
  766. Oct 27 20:18:09 localhost kernel: [ 1.510817] scsi host5: ahci
  767. Oct 27 20:18:09 localhost kernel: [ 1.510874] ata1: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305100 irq 27
  768. Oct 27 20:18:09 localhost kernel: [ 1.510877] ata2: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305180 irq 27
  769. Oct 27 20:18:09 localhost kernel: [ 1.510877] ata3: DUMMY
  770. Oct 27 20:18:09 localhost kernel: [ 1.510878] ata4: DUMMY
  771. Oct 27 20:18:09 localhost kernel: [ 1.510881] ata5: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305300 irq 27
  772. Oct 27 20:18:09 localhost kernel: [ 1.510883] ata6: SATA max UDMA/133 abar m2048@0xfb305000 port 0xfb305380 irq 27
  773. Oct 27 20:18:09 localhost kernel: [ 1.596039] usb 1-1: new high-speed USB device number 2 using ehci-pci
  774. Oct 27 20:18:09 localhost kernel: [ 1.616038] usb 2-1: new high-speed USB device number 2 using ehci-pci
  775. Oct 27 20:18:09 localhost kernel: [ 1.752509] usb 1-1: New USB device found, idVendor=8087, idProduct=0024
  776. Oct 27 20:18:09 localhost kernel: [ 1.752511] usb 1-1: New USB device strings: Mfr=0, Product=0, SerialNumber=0
  777. Oct 27 20:18:09 localhost kernel: [ 1.752863] hub 1-1:1.0: USB hub found
  778. Oct 27 20:18:09 localhost kernel: [ 1.752956] hub 1-1:1.0: 4 ports detected
  779. Oct 27 20:18:09 localhost kernel: [ 1.772475] usb 2-1: New USB device found, idVendor=8087, idProduct=0024
  780. Oct 27 20:18:09 localhost kernel: [ 1.772478] usb 2-1: New USB device strings: Mfr=0, Product=0, SerialNumber=0
  781. Oct 27 20:18:09 localhost kernel: [ 1.772752] hub 2-1:1.0: USB hub found
  782. Oct 27 20:18:09 localhost kernel: [ 1.772805] hub 2-1:1.0: 6 ports detected
  783. Oct 27 20:18:09 localhost kernel: [ 1.826635] ata1: SATA link up 3.0 Gbps (SStatus 123 SControl 300)
  784. Oct 27 20:18:09 localhost kernel: [ 1.826666] ata2: SATA link up 3.0 Gbps (SStatus 123 SControl 300)
  785. Oct 27 20:18:09 localhost kernel: [ 1.826683] ata5: SATA link up 1.5 Gbps (SStatus 113 SControl 300)
  786. Oct 27 20:18:09 localhost kernel: [ 1.826700] ata6: SATA link down (SStatus 0 SControl 300)
  787. Oct 27 20:18:09 localhost kernel: [ 1.827295] ata1.00: ATA-9: WDC WD30EFRX-68AX9N0, 80.00A80, max UDMA/133
  788. Oct 27 20:18:09 localhost kernel: [ 1.827298] ata1.00: 5860533168 sectors, multi 16: LBA48 NCQ (depth 31/32), AA
  789. Oct 27 20:18:09 localhost kernel: [ 1.828048] ata1.00: configured for UDMA/133
  790. Oct 27 20:18:09 localhost kernel: [ 1.828330] scsi 0:0:0:0: Direct-Access ATA WDC WD30EFRX-68A 0A80 PQ: 0 ANSI: 5
  791. Oct 27 20:18:09 localhost kernel: [ 1.828584] sd 0:0:0:0: Attached scsi generic sg0 type 0
  792. Oct 27 20:18:09 localhost kernel: [ 1.828691] sd 0:0:0:0: [sda] 5860533168 512-byte logical blocks: (3.00 TB/2.73 TiB)
  793. Oct 27 20:18:09 localhost kernel: [ 1.828693] sd 0:0:0:0: [sda] 4096-byte physical blocks
  794. Oct 27 20:18:09 localhost kernel: [ 1.828704] sd 0:0:0:0: [sda] Write Protect is off
  795. Oct 27 20:18:09 localhost kernel: [ 1.828706] sd 0:0:0:0: [sda] Mode Sense: 00 3a 00 00
  796. Oct 27 20:18:09 localhost kernel: [ 1.828726] sd 0:0:0:0: [sda] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA
  797. Oct 27 20:18:09 localhost kernel: [ 1.829126] ata5.00: ATAPI: ATAPI iHAS122, ZL0F, max UDMA/100
  798. Oct 27 20:18:09 localhost kernel: [ 1.829912] ata5.00: configured for UDMA/100
  799. Oct 27 20:18:09 localhost kernel: [ 1.833456] ata2.00: ATA-10: KINGSTON SA400S37120G, R0105A, max UDMA/133
  800. Oct 27 20:18:09 localhost kernel: [ 1.833459] ata2.00: 234441648 sectors, multi 1: LBA48 NCQ (depth 31/32), AA
  801. Oct 27 20:18:09 localhost kernel: [ 1.844050] ata2.00: configured for UDMA/133
  802. Oct 27 20:18:09 localhost kernel: [ 1.844338] scsi 1:0:0:0: Direct-Access ATA KINGSTON SA400S3 5A PQ: 0 ANSI: 5
  803. Oct 27 20:18:09 localhost kernel: [ 1.844679] sd 1:0:0:0: Attached scsi generic sg1 type 0
  804. Oct 27 20:18:09 localhost kernel: [ 1.844882] sd 1:0:0:0: [sdb] 234441648 512-byte logical blocks: (120 GB/112 GiB)
  805. Oct 27 20:18:09 localhost kernel: [ 1.844889] sd 1:0:0:0: [sdb] Write Protect is off
  806. Oct 27 20:18:09 localhost kernel: [ 1.844891] sd 1:0:0:0: [sdb] Mode Sense: 00 3a 00 00
  807. Oct 27 20:18:09 localhost kernel: [ 1.844904] sd 1:0:0:0: [sdb] Write cache: enabled, read cache: enabled, doesn't support DPO or FUA
  808. Oct 27 20:18:09 localhost kernel: [ 1.845676] sdb: sdb1 sdb2
  809. Oct 27 20:18:09 localhost kernel: [ 1.846126] sd 1:0:0:0: [sdb] Attached SCSI disk
  810. Oct 27 20:18:09 localhost kernel: [ 1.848171] scsi 4:0:0:0: CD-ROM ATAPI iHAS122 ZL0F PQ: 0 ANSI: 5
  811. Oct 27 20:18:09 localhost kernel: [ 1.877895] sda: sda1 sda2 sda3 sda4 sda5 sda6
  812. Oct 27 20:18:09 localhost kernel: [ 1.878396] sd 0:0:0:0: [sda] Attached SCSI disk
  813. Oct 27 20:18:09 localhost kernel: [ 1.924823] sr 4:0:0:0: [sr0] scsi3-mmc drive: 48x/48x writer dvd-ram cd/rw xa/form2 cdda tray
  814. Oct 27 20:18:09 localhost kernel: [ 1.924825] cdrom: Uniform CD-ROM driver Revision: 3.20
  815. Oct 27 20:18:09 localhost kernel: [ 1.924938] sr 4:0:0:0: Attached scsi CD-ROM sr0
  816. Oct 27 20:18:09 localhost kernel: [ 1.924992] sr 4:0:0:0: Attached scsi generic sg2 type 5
  817. Oct 27 20:18:09 localhost kernel: [ 2.040051] usb 1-1.1: new full-speed USB device number 3 using ehci-pci
  818. Oct 27 20:18:09 localhost kernel: [ 2.060043] usb 2-1.2: new high-speed USB device number 3 using ehci-pci
  819. Oct 27 20:18:09 localhost kernel: [ 2.150058] usb 1-1.1: New USB device found, idVendor=0403, idProduct=6001
  820. Oct 27 20:18:09 localhost kernel: [ 2.150061] usb 1-1.1: New USB device strings: Mfr=0, Product=0, SerialNumber=3
  821. Oct 27 20:18:09 localhost kernel: [ 2.150062] usb 1-1.1: SerialNumber: Reader 3FB4612
  822. Oct 27 20:18:09 localhost kernel: [ 2.150302] random: fast init done
  823. Oct 27 20:18:09 localhost kernel: [ 2.150365] random: systemd-udevd: uninitialized urandom read (16 bytes read)
  824. Oct 27 20:18:09 localhost kernel: [ 2.150372] random: systemd-udevd: uninitialized urandom read (16 bytes read)
  825. Oct 27 20:18:09 localhost kernel: [ 2.150589] random: systemd-udevd: uninitialized urandom read (16 bytes read)
  826. Oct 27 20:18:09 localhost kernel: [ 2.168933] usb 2-1.2: New USB device found, idVendor=0781, idProduct=5571
  827. Oct 27 20:18:09 localhost kernel: [ 2.168935] usb 2-1.2: New USB device strings: Mfr=1, Product=2, SerialNumber=3
  828. Oct 27 20:18:09 localhost kernel: [ 2.168936] usb 2-1.2: Product: Cruzer Fit
  829. Oct 27 20:18:09 localhost kernel: [ 2.168937] usb 2-1.2: Manufacturer: SanDisk
  830. Oct 27 20:18:09 localhost kernel: [ 2.168939] usb 2-1.2: SerialNumber: 4C530010201112117272
  831. Oct 27 20:18:09 localhost kernel: [ 2.172610] usb-storage 2-1.2:1.0: USB Mass Storage device detected
  832. Oct 27 20:18:09 localhost kernel: [ 2.172711] scsi host6: usb-storage 2-1.2:1.0
  833. Oct 27 20:18:09 localhost kernel: [ 2.172781] usbcore: registered new interface driver usb-storage
  834. Oct 27 20:18:09 localhost kernel: [ 2.174177] usbcore: registered new interface driver uas
  835. Oct 27 20:18:09 localhost kernel: [ 2.236036] tsc: Refined TSC clocksource calibration: 2394.559 MHz
  836. Oct 27 20:18:09 localhost kernel: [ 2.236045] clocksource: tsc: mask: 0xffffffffffffffff max_cycles: 0x2284235ba97, max_idle_ns: 440795203400 ns
  837. Oct 27 20:18:09 localhost kernel: [ 2.248043] usb 2-1.5: new low-speed USB device number 4 using ehci-pci
  838. Oct 27 20:18:09 localhost kernel: [ 2.363838] usb 2-1.5: New USB device found, idVendor=046a, idProduct=b090
  839. Oct 27 20:18:09 localhost kernel: [ 2.363841] usb 2-1.5: New USB device strings: Mfr=1, Product=2, SerialNumber=0
  840. Oct 27 20:18:09 localhost kernel: [ 2.363842] usb 2-1.5: Product: USB keyboard
  841. Oct 27 20:18:09 localhost kernel: [ 2.363843] usb 2-1.5: Manufacturer: Cherry
  842. Oct 27 20:18:09 localhost kernel: [ 2.367911] hidraw: raw HID events driver (C) Jiri Kosina
  843. Oct 27 20:18:09 localhost kernel: [ 2.379215] usbcore: registered new interface driver usbhid
  844. Oct 27 20:18:09 localhost kernel: [ 2.379217] usbhid: USB HID core driver
  845. Oct 27 20:18:09 localhost kernel: [ 2.381534] input: Cherry USB keyboard as /devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.5/2-1.5:1.0/0003:046A:B090.0001/input/input2
  846. Oct 27 20:18:09 localhost kernel: [ 2.440296] hid-generic 0003:046A:B090.0001: input,hidraw0: USB HID v1.11 Keyboard [Cherry USB keyboard] on usb-0000:00:1d.0-1.5/input0
  847. Oct 27 20:18:09 localhost kernel: [ 2.440453] input: Cherry USB keyboard as /devices/pci0000:00/0000:00:1d.0/usb2/2-1/2-1.5/2-1.5:1.1/0003:046A:B090.0002/input/input3
  848. Oct 27 20:18:09 localhost kernel: [ 2.500506] hid-generic 0003:046A:B090.0002: input,hiddev0,hidraw1: USB HID v1.11 Device [Cherry USB keyboard] on usb-0000:00:1d.0-1.5/input1
  849. Oct 27 20:18:09 localhost kernel: [ 2.980021] raid6: sse2x1 gen() 7071 MB/s
  850. Oct 27 20:18:09 localhost kernel: [ 3.028021] raid6: sse2x1 xor() 4844 MB/s
  851. Oct 27 20:18:09 localhost kernel: [ 3.076019] raid6: sse2x2 gen() 8296 MB/s
  852. Oct 27 20:18:09 localhost kernel: [ 3.124023] raid6: sse2x2 xor() 5612 MB/s
  853. Oct 27 20:18:09 localhost kernel: [ 3.172017] raid6: sse2x4 gen() 9881 MB/s
  854. Oct 27 20:18:09 localhost kernel: [ 3.196729] scsi 6:0:0:0: Direct-Access SanDisk Cruzer Fit 1.27 PQ: 0 ANSI: 6
  855. Oct 27 20:18:09 localhost kernel: [ 3.197020] sd 6:0:0:0: Attached scsi generic sg3 type 0
  856. Oct 27 20:18:09 localhost kernel: [ 3.197689] sd 6:0:0:0: [sdc] 31266816 512-byte logical blocks: (16.0 GB/14.9 GiB)
  857. Oct 27 20:18:09 localhost kernel: [ 3.198689] sd 6:0:0:0: [sdc] Write Protect is off
  858. Oct 27 20:18:09 localhost kernel: [ 3.198691] sd 6:0:0:0: [sdc] Mode Sense: 43 00 00 00
  859. Oct 27 20:18:09 localhost kernel: [ 3.199696] sd 6:0:0:0: [sdc] Write cache: disabled, read cache: enabled, doesn't support DPO or FUA
  860. Oct 27 20:18:09 localhost kernel: [ 3.203955] sdc: sdc1 sdc2 sdc3
  861. Oct 27 20:18:09 localhost kernel: [ 3.206819] sd 6:0:0:0: [sdc] Attached SCSI disk
  862. Oct 27 20:18:09 localhost kernel: [ 3.220022] raid6: sse2x4 xor() 6503 MB/s
  863. Oct 27 20:18:09 localhost kernel: [ 3.220024] raid6: using algorithm sse2x4 gen() 9881 MB/s
  864. Oct 27 20:18:09 localhost kernel: [ 3.220024] raid6: .... xor() 6503 MB/s, rmw enabled
  865. Oct 27 20:18:09 localhost kernel: [ 3.220026] raid6: using ssse3x2 recovery algorithm
  866. Oct 27 20:18:09 localhost kernel: [ 3.221497] xor: measuring software checksum speed
  867. Oct 27 20:18:09 localhost kernel: [ 3.260019] prefetch64-sse: 12693.000 MB/sec
  868. Oct 27 20:18:09 localhost kernel: [ 3.300017] generic_sse: 11716.000 MB/sec
  869. Oct 27 20:18:09 localhost kernel: [ 3.300018] xor: using function: prefetch64-sse (12693.000 MB/sec)
  870. Oct 27 20:18:09 localhost kernel: [ 3.300039] clocksource: Switched to clocksource tsc
  871. Oct 27 20:18:09 localhost kernel: [ 3.301379] async_tx: api initialized (async)
  872. Oct 27 20:18:09 localhost kernel: [ 3.366090] Btrfs loaded, crc32c=crc32c-intel
  873. Oct 27 20:18:09 localhost kernel: [ 4.087743] EXT4-fs (sdb1): mounted filesystem with ordered data mode. Opts: (null)
  874. Oct 27 20:18:09 localhost kernel: [ 4.289987] ip_tables: (C) 2000-2006 Netfilter Core Team
  875. Oct 27 20:18:09 localhost kernel: [ 4.298348] systemd[1]: systemd 237 running in system mode. (+PAM +AUDIT +SELINUX +IMA +APPARMOR +SMACK +SYSVINIT +UTMP +LIBCRYPTSETUP +GCRYPT +GNUTLS +ACL +XZ +LZ4 +SECCOMP +BLKID +ELFUTILS +KMOD -IDN2 +IDN -PCRE2 default-hierarchy=hybrid)
  876. Oct 27 20:18:09 localhost kernel: [ 4.316149] systemd[1]: Detected architecture x86-64.
  877. Oct 27 20:18:09 localhost kernel: [ 4.318067] systemd[1]: Set hostname to <myVDR>.
  878. Oct 27 20:18:09 localhost kernel: [ 4.494670] systemd[1]: vdr-addon-lifeguard-ng.service: Service has a D-Bus service name specified, but is not of type dbus. Ignoring.
  879. Oct 27 20:18:09 localhost kernel: [ 4.539466] systemd[1]: Reached target User and Group Name Lookups.
  880. Oct 27 20:18:09 localhost kernel: [ 4.540332] systemd[1]: Created slice User and Session Slice.
  881. Oct 27 20:18:09 localhost kernel: [ 4.540555] systemd[1]: Set up automount Arbitrary Executable File Formats File System Automount Point.
  882. Oct 27 20:18:09 localhost kernel: [ 4.540620] systemd[1]: Started Forward Password Requests to Wall Directory Watch.
  883. Oct 27 20:18:09 localhost kernel: [ 4.540983] systemd[1]: Created slice System Slice.
  884. Oct 27 20:18:09 localhost kernel: [ 4.541078] systemd[1]: Listening on RPCbind Server Activation Socket.
  885. Oct 27 20:18:09 localhost kernel: [ 4.594116] Loading iSCSI transport class v2.0-870.
  886. Oct 27 20:18:09 localhost kernel: [ 4.600956] iscsi: registered transport (tcp)
  887. Oct 27 20:18:09 localhost kernel: [ 4.617375] EXT4-fs (sdb1): re-mounted. Opts: errors=remount-ro
  888. Oct 27 20:18:09 localhost kernel: [ 4.655330] iscsi: registered transport (iser)
  889. Oct 27 20:18:09 localhost kernel: [ 4.742006] systemd-journald[393]: Received request to flush runtime journal from PID 1
  890. Oct 27 20:18:09 localhost kernel: [ 4.764199] RPC: Registered named UNIX socket transport module.
  891. Oct 27 20:18:09 localhost kernel: [ 4.764200] RPC: Registered udp transport module.
  892. Oct 27 20:18:09 localhost kernel: [ 4.764201] RPC: Registered tcp transport module.
  893. Oct 27 20:18:09 localhost kernel: [ 4.764202] RPC: Registered tcp NFSv4.1 backchannel transport module.
  894. Oct 27 20:18:09 localhost kernel: [ 4.771201] random: crng init done
  895. Oct 27 20:18:09 localhost kernel: [ 4.771204] random: 7 urandom warning(s) missed due to ratelimiting
  896. Oct 27 20:18:09 localhost kernel: [ 4.824882] Installing knfsd (copyright (C) 1996 okir@monad.swb.de).
  897. Oct 27 20:18:09 localhost kernel: [ 5.118682] systemd-journald[393]: File /var/log/journal/5f8468ca6e4c430ab172e3c83e833eaf/system.journal corrupted or uncleanly shut down, renaming and replacing.
  898. Oct 27 20:18:09 localhost kernel: [ 5.563978] ACPI Warning: SystemIO range 0x0000000000000540-0x000000000000054F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  899. Oct 27 20:18:09 localhost kernel: [ 5.563984] ACPI Warning: SystemIO range 0x0000000000000540-0x000000000000054F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  900. Oct 27 20:18:09 localhost kernel: [ 5.563988] ACPI: If an ACPI driver is available for this device, you should use it instead of the native driver
  901. Oct 27 20:18:09 localhost kernel: [ 5.563989] ACPI Warning: SystemIO range 0x0000000000000530-0x000000000000053F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  902. Oct 27 20:18:09 localhost kernel: [ 5.563992] ACPI Warning: SystemIO range 0x0000000000000530-0x000000000000053F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  903. Oct 27 20:18:09 localhost kernel: [ 5.563995] ACPI: If an ACPI driver is available for this device, you should use it instead of the native driver
  904. Oct 27 20:18:09 localhost kernel: [ 5.563996] ACPI Warning: SystemIO range 0x0000000000000500-0x000000000000052F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  905. Oct 27 20:18:09 localhost kernel: [ 5.563999] ACPI Warning: SystemIO range 0x0000000000000500-0x000000000000052F conflicts with OpRegion 0x0000000000000500-0x000000000000057F (\GPR2) (20170831/utaddress-247)
  906. Oct 27 20:18:09 localhost kernel: [ 5.564002] ACPI: If an ACPI driver is available for this device, you should use it instead of the native driver
  907. Oct 27 20:18:09 localhost kernel: [ 5.564002] lpc_ich: Resource conflict(s) found affecting gpio_ich
  908. Oct 27 20:18:09 localhost kernel: [ 5.574915] shpchp: Standard Hot Plug PCI Controller Driver version: 0.4
  909. Oct 27 20:18:09 localhost kernel: [ 5.696632] parport_pc 00:02: reported by Plug and Play ACPI
  910. Oct 27 20:18:09 localhost kernel: [ 5.696722] parport0: PC-style at 0x378 (0x778), irq 5, dma 3 [PCSPP,TRISTATE,COMPAT,EPP,ECP,DMA]
  911. Oct 27 20:18:09 localhost kernel: [ 5.703762] nvidia-uvm: Loaded the UVM driver in 8 mode, major device number 240
  912. Oct 27 20:18:09 localhost kernel: [ 5.780970] snd_hda_intel 0000:01:00.1: Disabling MSI
  913. Oct 27 20:18:09 localhost kernel: [ 5.780977] snd_hda_intel 0000:01:00.1: Handle vga_switcheroo audio client
  914. Oct 27 20:18:09 localhost kernel: [ 5.781544] snd_hda_codec_realtek hdaudioC0D0: autoconfig for ALC887-VD: line_outs=3 (0x14/0x15/0x16/0x0/0x0) type:line
  915. Oct 27 20:18:09 localhost kernel: [ 5.781547] snd_hda_codec_realtek hdaudioC0D0: speaker_outs=0 (0x0/0x0/0x0/0x0/0x0)
  916. Oct 27 20:18:09 localhost kernel: [ 5.781548] snd_hda_codec_realtek hdaudioC0D0: hp_outs=1 (0x1b/0x0/0x0/0x0/0x0)
  917. Oct 27 20:18:09 localhost kernel: [ 5.781549] snd_hda_codec_realtek hdaudioC0D0: mono: mono_out=0x0
  918. Oct 27 20:18:09 localhost kernel: [ 5.781550] snd_hda_codec_realtek hdaudioC0D0: dig-out=0x1e/0x0
  919. Oct 27 20:18:09 localhost kernel: [ 5.781551] snd_hda_codec_realtek hdaudioC0D0: inputs:
  920. Oct 27 20:18:09 localhost kernel: [ 5.781553] snd_hda_codec_realtek hdaudioC0D0: Front Mic=0x19
  921. Oct 27 20:18:09 localhost kernel: [ 5.781555] snd_hda_codec_realtek hdaudioC0D0: Rear Mic=0x18
  922. Oct 27 20:18:09 localhost kernel: [ 5.781556] snd_hda_codec_realtek hdaudioC0D0: Line=0x1a
  923. Oct 27 20:18:09 localhost kernel: [ 5.797025] nuvoton-cir 00:03: found NCT6776F or compatible: chip id: 0xc3 0x33
  924. Oct 27 20:18:09 localhost kernel: [ 5.797708] input: HDA Intel PCH Rear Mic as /devices/pci0000:00/0000:00:1b.0/sound/card0/input4
  925. Oct 27 20:18:09 localhost kernel: [ 5.797779] input: HDA Intel PCH Line as /devices/pci0000:00/0000:00:1b.0/sound/card0/input5
  926. Oct 27 20:18:09 localhost kernel: [ 5.797833] input: HDA Intel PCH Line Out Front as /devices/pci0000:00/0000:00:1b.0/sound/card0/input6
  927. Oct 27 20:18:09 localhost kernel: [ 5.797921] input: HDA Intel PCH Line Out Surround as /devices/pci0000:00/0000:00:1b.0/sound/card0/input7
  928. Oct 27 20:18:09 localhost kernel: [ 5.797983] input: HDA Intel PCH Line Out CLFE as /devices/pci0000:00/0000:00:1b.0/sound/card0/input8
  929. Oct 27 20:18:09 localhost kernel: [ 5.802118] lirc_dev: IR Remote Control driver registered, major 239
  930. Oct 27 20:18:09 localhost kernel: [ 5.803725] IR LIRC bridge handler initialized
  931. Oct 27 20:18:09 localhost kernel: [ 5.836080] Registered IR keymap rc-rc6-mce
  932. Oct 27 20:18:09 localhost kernel: [ 5.844298] IR RC6 protocol handler initialized
  933. Oct 27 20:18:09 localhost kernel: [ 5.844314] usbcore: registered new interface driver usbserial_generic
  934. Oct 27 20:18:09 localhost kernel: [ 5.844325] usbserial: USB Serial support registered for generic
  935. Oct 27 20:18:09 localhost kernel: [ 5.872116] rc rc0: Nuvoton w836x7hg Infrared Remote Transceiver as /devices/pnp0/00:03/rc/rc0
  936. Oct 27 20:18:09 localhost kernel: [ 5.872157] input: Nuvoton w836x7hg Infrared Remote Transceiver as /devices/pnp0/00:03/rc/rc0/input9
  937. Oct 27 20:18:09 localhost kernel: [ 5.874598] lirc lirc0: lirc_dev: driver ir-lirc-codec (nuvoton-cir) registered at minor = 0
  938. Oct 27 20:18:09 localhost kernel: [ 5.874620] nuvoton-cir 00:03: driver has been successfully loaded
  939. Oct 27 20:18:09 localhost kernel: [ 5.882118] usbcore: registered new interface driver ftdi_sio
  940. Oct 27 20:18:09 localhost kernel: [ 5.882129] usbserial: USB Serial support registered for FTDI USB Serial Device
  941. Oct 27 20:18:09 localhost kernel: [ 5.882411] ftdi_sio 1-1.1:1.0: FTDI USB Serial Device converter detected
  942. Oct 27 20:18:09 localhost kernel: [ 5.882443] usb 1-1.1: Detected FT232BM
  943. Oct 27 20:18:09 localhost kernel: [ 5.882668] ftdi_sio ttyUSB0: Unable to read latency timer: -32
  944. Oct 27 20:18:09 localhost kernel: [ 5.883038] usb 1-1.1: FTDI USB Serial Device converter now attached to ttyUSB0
  945. Oct 27 20:18:09 localhost kernel: [ 6.128483] saa7146: register extension 'budget_ci dvb'
  946. Oct 27 20:18:09 localhost kernel: [ 6.128722] saa7146: found saa7146 @ mem 00000000b1b49179 (revision 1, irq 17) (0x13c2,0x1019)
  947. Oct 27 20:18:09 localhost kernel: [ 6.128724] saa7146 (0): dma buffer size 192512
  948. Oct 27 20:18:09 localhost kernel: [ 6.128725] dvbdev: DVB: registering new adapter (TT-Budget S2-3200 PCI)
  949. Oct 27 20:18:09 localhost kernel: [ 6.177088] adapter has MAC addr = 00:d0:5c:68:37:b6
  950. Oct 27 20:18:09 localhost kernel: [ 6.364732] RAPL PMU: API unit is 2^-32 Joules, 3 fixed counters, 163840 ms ovfl timer
  951. Oct 27 20:18:09 localhost kernel: [ 6.364735] RAPL PMU: hw unit of domain pp0-core 2^-16 Joules
  952. Oct 27 20:18:09 localhost kernel: [ 6.364735] RAPL PMU: hw unit of domain package 2^-16 Joules
  953. Oct 27 20:18:09 localhost kernel: [ 6.364736] RAPL PMU: hw unit of domain pp1-gpu 2^-16 Joules
  954. Oct 27 20:18:09 localhost kernel: [ 6.368662] input: HDA NVidia HDMI/DP,pcm=3 as /devices/pci0000:00/0000:00:01.0/0000:01:00.1/sound/card1/input11
  955. Oct 27 20:18:09 localhost kernel: [ 6.368719] input: HDA NVidia HDMI/DP,pcm=7 as /devices/pci0000:00/0000:00:01.0/0000:01:00.1/sound/card1/input12
  956. Oct 27 20:18:09 localhost kernel: [ 6.380474] Registered IR keymap rc-tt-1500
  957. Oct 27 20:18:09 localhost kernel: [ 6.380515] rc rc1: Budget-CI dvb ir receiver saa7146 (0) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:00.0/rc/rc1
  958. Oct 27 20:18:09 localhost kernel: [ 6.380552] input: Budget-CI dvb ir receiver saa7146 (0) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:00.0/rc/rc1/input10
  959. Oct 27 20:18:09 localhost kernel: [ 6.741290] ppdev: user-space parallel port driver
  960. Oct 27 20:18:09 localhost kernel: [ 6.772937] resource sanity check: requesting [mem 0x000c0000-0x000fffff], which spans more than PCI Bus 0000:00 [mem 0x000c0000-0x000dffff window]
  961. Oct 27 20:18:09 localhost kernel: [ 6.773204] caller os_map_kernel_space.part.8+0x10b/0x150 [nvidia] mapping multiple BARs
  962. Oct 27 20:18:09 localhost kernel: [ 7.073699] stb0899_attach: Attaching STB0899
  963. Oct 27 20:18:09 localhost kernel: [ 7.083834] stb6100_attach: Attaching STB6100
  964. Oct 27 20:18:09 localhost kernel: [ 7.091753] LNBx2x attached on addr=8
  965. Oct 27 20:18:09 localhost kernel: [ 7.091757] budget_ci dvb 0000:04:00.0: DVB: registering adapter 0 frontend 0 (STB0899 Multistandard)...
  966. Oct 27 20:18:09 localhost kernel: [ 7.092004] saa7146: found saa7146 @ mem 000000000530131b (revision 1, irq 18) (0x13c2,0x1019)
  967. Oct 27 20:18:09 localhost kernel: [ 7.092006] saa7146 (1): dma buffer size 192512
  968. Oct 27 20:18:09 localhost kernel: [ 7.092007] dvbdev: DVB: registering new adapter (TT-Budget S2-3200 PCI)
  969. Oct 27 20:18:09 localhost kernel: [ 7.102653] intel_rapl: Found RAPL domain package
  970. Oct 27 20:18:09 localhost kernel: [ 7.102654] intel_rapl: Found RAPL domain core
  971. Oct 27 20:18:09 localhost kernel: [ 7.102655] intel_rapl: Found RAPL domain uncore
  972. Oct 27 20:18:09 localhost kernel: [ 7.102660] intel_rapl: RAPL package 0 domain package locked by BIOS
  973. Oct 27 20:18:09 localhost kernel: [ 7.145919] adapter has MAC addr = 00:d0:5c:68:30:6d
  974. Oct 27 20:18:09 localhost kernel: [ 7.160388] Registered IR keymap rc-tt-1500
  975. Oct 27 20:18:09 localhost kernel: [ 7.160424] rc rc2: Budget-CI dvb ir receiver saa7146 (1) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:01.0/rc/rc2
  976. Oct 27 20:18:09 localhost kernel: [ 7.160459] input: Budget-CI dvb ir receiver saa7146 (1) as /devices/pci0000:00/0000:00:1c.1/0000:03:00.0/0000:04:01.0/rc/rc2/input13
  977. Oct 27 20:18:09 localhost kernel: [ 7.500685] stb0899_attach: Attaching STB0899
  978. Oct 27 20:18:09 localhost kernel: [ 7.500693] stb6100_attach: Attaching STB6100
  979. Oct 27 20:18:09 localhost kernel: [ 7.500807] LNBx2x attached on addr=8
  980. Oct 27 20:18:09 localhost kernel: [ 7.500812] budget_ci dvb 0000:04:01.0: DVB: registering adapter 1 frontend 0 (STB0899 Multistandard)...
  981. Oct 27 20:18:09 localhost kernel: [ 7.523608] Adding 5242876k swap on /dev/sdb2. Priority:-2 extents:1 across:5242876k SSFS
  982. Oct 27 20:18:09 localhost kernel: [ 8.274179] EXT4-fs (sda4): mounted filesystem with ordered data mode. Opts: (null)
  983. Oct 27 20:18:09 localhost kernel: [ 8.495649] atl1c 0000:05:00.0: atl1c: enp5s0 NIC Link is Up<1000 Mbps Full Duplex>
  984. Oct 27 20:18:09 localhost kernel: [ 8.568083] audit: type=1400 audit(1572203889.767:2): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/sbin/dhclient" pid=831 comm="apparmor_parser"
  985. Oct 27 20:18:09 localhost kernel: [ 8.568088] audit: type=1400 audit(1572203889.767:3): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/lib/NetworkManager/nm-dhcp-client.action" pid=831 comm="apparmor_parser"
  986. Oct 27 20:18:09 localhost kernel: [ 8.568090] audit: type=1400 audit(1572203889.767:4): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/lib/NetworkManager/nm-dhcp-helper" pid=831 comm="apparmor_parser"
  987. Oct 27 20:18:09 localhost kernel: [ 8.568092] audit: type=1400 audit(1572203889.767:5): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/lib/connman/scripts/dhclient-script" pid=831 comm="apparmor_parser"
  988. Oct 27 20:18:09 localhost kernel: [ 8.575102] audit: type=1400 audit(1572203889.771:6): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default" pid=830 comm="apparmor_parser"
  989. Oct 27 20:18:09 localhost kernel: [ 8.575107] audit: type=1400 audit(1572203889.771:7): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default-cgns" pid=830 comm="apparmor_parser"
  990. Oct 27 20:18:09 localhost kernel: [ 8.575108] audit: type=1400 audit(1572203889.771:8): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default-with-mounting" pid=830 comm="apparmor_parser"
  991. Oct 27 20:18:09 localhost kernel: [ 8.575111] audit: type=1400 audit(1572203889.771:9): apparmor="STATUS" operation="profile_load" profile="unconfined" name="lxc-container-default-with-nesting" pid=830 comm="apparmor_parser"
  992. Oct 27 20:18:09 localhost kernel: [ 8.576231] audit: type=1400 audit(1572203889.775:10): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/bin/lxc-start" pid=833 comm="apparmor_parser"
  993. Oct 27 20:18:09 localhost kernel: [ 8.578443] audit: type=1400 audit(1572203889.775:11): apparmor="STATUS" operation="profile_load" profile="unconfined" name="/usr/bin/man" pid=834 comm="apparmor_parser"
  994. Oct 27 20:18:09 localhost systemd[1]: Started System Logging Service.
  995. Oct 27 20:18:09 localhost rsyslogd: imuxsock: Acquired UNIX socket '/run/systemd/journal/syslog' (fd 3) from systemd. [v8.32.0]
  996. Oct 27 20:18:09 localhost rsyslogd: rsyslogd's groupid changed to 106
  997. Oct 27 20:18:09 localhost rsyslogd: rsyslogd's userid changed to 102
  998. Oct 27 20:18:09 localhost rsyslogd: [origin software="rsyslogd" swVersion="8.32.0" x-pid="871" x-info="http://www.rsyslog.com"] start
  999. Oct 27 20:18:09 localhost avahi-daemon[860]: Successfully dropped root privileges.
  1000. Oct 27 20:18:09 localhost avahi-daemon[860]: avahi-daemon 0.7 starting up.
  1001. Oct 27 20:18:09 localhost cron[869]: (CRON) INFO (Running @reboot jobs)
  1002. Oct 27 20:18:09 localhost systemd[1]: Started Save/Restore Sound Card State.
  1003. Oct 27 20:18:09 localhost systemd[1]: Started Avahi mDNS/DNS-SD Stack.
  1004. Oct 27 20:18:09 localhost avahi-daemon[860]: Successfully called chroot().
  1005. Oct 27 20:18:09 localhost avahi-daemon[860]: Successfully dropped remaining capabilities.
  1006. Oct 27 20:18:09 localhost sensors[900]: coretemp-isa-0000
  1007. Oct 27 20:18:09 localhost sensors[900]: Adapter: ISA adapter
  1008. Oct 27 20:18:09 localhost sensors[900]: Package id 0: +38.0°C (high = +82.0°C, crit = +102.0°C)
  1009. Oct 27 20:18:09 localhost sensors[900]: Core 0: +34.0°C (high = +82.0°C, crit = +102.0°C)
  1010. Oct 27 20:18:09 localhost sensors[900]: Core 1: +38.0°C (high = +82.0°C, crit = +102.0°C)
  1011. Oct 27 20:18:09 localhost systemd[1]: Started Initialize hardware monitoring sensors.
  1012. Oct 27 20:18:09 localhost kernel: [ 8.784920] new mount options do not match the existing superblock, will be ignored
  1013. Oct 27 20:18:09 localhost grub-common[870]: * Recording successful boot for GRUB
  1014. Oct 27 20:18:10 localhost lxcfs[877]: mount namespace: 5
  1015. Oct 27 20:18:10 localhost lxcfs[877]: hierarchies:
  1016. Oct 27 20:18:10 localhost lxcfs[877]: 0: fd: 6: pids
  1017. Oct 27 20:18:10 localhost lxcfs[877]: 1: fd: 7: hugetlb
  1018. Oct 27 20:18:10 localhost lxcfs[877]: 2: fd: 8: rdma
  1019. Oct 27 20:18:10 localhost lxcfs[877]: 3: fd: 9: cpu,cpuacct
  1020. Oct 27 20:18:10 localhost lxcfs[877]: 4: fd: 10: memory
  1021. Oct 27 20:18:10 localhost lxcfs[877]: 5: fd: 11: net_cls,net_prio
  1022. Oct 27 20:18:10 localhost lxcfs[877]: 6: fd: 12: cpuset
  1023. Oct 27 20:18:10 localhost lxcfs[877]: 7: fd: 13: freezer
  1024. Oct 27 20:18:10 localhost lxcfs[877]: 8: fd: 14: devices
  1025. Oct 27 20:18:10 localhost lxcfs[877]: 9: fd: 15: blkio
  1026. Oct 27 20:18:10 localhost lxcfs[877]: 10: fd: 16: perf_event
  1027. Oct 27 20:18:10 localhost lxcfs[877]: 11: fd: 17: name=systemd
  1028. Oct 27 20:18:10 localhost lxcfs[877]: 12: fd: 18: unified
  1029. Oct 27 20:18:10 localhost systemd[1]: Started WPA supplicant.
  1030. Oct 27 20:18:10 localhost wpa_supplicant[884]: Successfully initialized wpa_supplicant
  1031. Oct 27 20:18:10 localhost systemd[1]: Reached target Network.
  1032. Oct 27 20:18:10 localhost systemd[1]: Starting MariaDB 10.1.41 database server...
  1033. Oct 27 20:18:10 localhost systemd[1]: Starting OScam...
  1034. Oct 27 20:18:10 localhost systemd[1]: Starting NFS Mount Daemon...
  1035. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-audio.service.
  1036. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-backups.service.
  1037. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-files.service.
  1038. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-pictures.service.
  1039. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-recordings.service.
  1040. Oct 27 20:18:10 localhost avahi-daemon[860]: Loading service file /services/yavdr-video.service.
  1041. Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface enp5s0.IPv6 with address fe80::225:22ff:fee6:40ba.
  1042. Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface enp5s0.IPv6 for mDNS.
  1043. Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface enp5s0.IPv4 with address 192.168.192.150.
  1044. Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface enp5s0.IPv4 for mDNS.
  1045. Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface lo.IPv6 with address ::1.
  1046. Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface lo.IPv6 for mDNS.
  1047. Oct 27 20:18:10 localhost avahi-daemon[860]: Joining mDNS multicast group on interface lo.IPv4 with address 127.0.0.1.
  1048. Oct 27 20:18:10 localhost avahi-daemon[860]: New relevant interface lo.IPv4 for mDNS.
  1049. Oct 27 20:18:10 localhost avahi-daemon[860]: Network interface enumeration completed.
  1050. Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for fe80::225:22ff:fee6:40ba on enp5s0.*.
  1051. Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for 192.168.192.150 on enp5s0.IPv4.
  1052. Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for ::1 on lo.*.
  1053. Oct 27 20:18:10 localhost avahi-daemon[860]: Registering new address record for 127.0.0.1 on lo.IPv4.
  1054. Oct 27 20:18:10 localhost systemd[1]: Started Login Service.
  1055. Oct 27 20:18:10 localhost systemd[1]: Started Unattended Upgrades Shutdown.
  1056. Oct 27 20:18:10 localhost systemd[1]: Started LXD - container startup/shutdown.
  1057. Oct 27 20:18:10 localhost udisksd[879]: udisks daemon version 2.7.6 starting
  1058. Oct 27 20:18:10 localhost dbus-daemon[883]: [system] Activating via systemd: service name='org.freedesktop.PolicyKit1' unit='polkit.service' requested by ':1.6' (uid=0 pid=881 comm="/usr/lib/accountsservice/accounts-daemon " label="unconfined")
  1059. Oct 27 20:18:10 localhost systemd[1]: Starting Authorization Manager...
  1060. Oct 27 20:18:10 localhost systemd[1]: oscam.service: Can't open PID file /var/run/oscam.pid (yet?) after start: No such file or directory
  1061. Oct 27 20:18:10 localhost grub-common[870]: ...done.
  1062. Oct 27 20:18:10 localhost systemd[1]: Started LSB: Record successful boot for GRUB.
  1063. Oct 27 20:18:10 localhost systemd[1]: oscam.service: Supervising process 923 which is not our child. We'll most likely not notice when it exits.
  1064. Oct 27 20:18:10 localhost systemd[1]: Started OScam.
  1065. Oct 27 20:18:10 localhost snapd[874]: AppArmor status: apparmor is enabled and all features are available
  1066. Oct 27 20:18:10 localhost systemd[1]: Started lircd(8) initialization helper tool.
  1067. Oct 27 20:18:10 localhost udisksd[879]: failed to load module crypto: libbd_crypto.so.2: cannot open shared object file: No such file or directory
  1068. Oct 27 20:18:10 localhost udisksd[879]: failed to load module mdraid: libbd_mdraid.so.2: cannot open shared object file: No such file or directory
  1069. Oct 27 20:18:10 localhost udisksd[879]: Failed to load the 'mdraid' libblockdev plugin
  1070. Oct 27 20:18:10 localhost udisksd[879]: Failed to load the 'crypto' libblockdev plugin
  1071. Oct 27 20:18:10 localhost kernel: [ 9.043918] ftdi_sio ttyUSB0: FTDI USB Serial Device converter now disconnected from ttyUSB0
  1072. Oct 27 20:18:10 localhost kernel: [ 9.043935] ftdi_sio 1-1.1:1.0: device disconnected
  1073. Oct 27 20:18:10 localhost polkitd[920]: started daemon version 0.105 using authority implementation `local' version `0.105'
  1074. Oct 27 20:18:10 localhost dbus-daemon[883]: [system] Successfully activated service 'org.freedesktop.PolicyKit1'
  1075. Oct 27 20:18:10 localhost systemd[1]: Started Authorization Manager.
  1076. Oct 27 20:18:10 localhost accounts-daemon[881]: started daemon version 0.6.45
  1077. Oct 27 20:18:10 localhost systemd[1]: Started Accounts Service.
  1078. Oct 27 20:18:10 localhost rpc.mountd[953]: Version 1.3.3 starting
  1079. Oct 27 20:18:10 localhost systemd[1]: Started NFS Mount Daemon.
  1080. Oct 27 20:18:10 localhost systemd[1]: Starting NFS server and services...
  1081. Oct 27 20:18:10 localhost snapd[874]: daemon.go:338: started snapd/2.40+18.04 (series 16; classic) ubuntu/18.04 (amd64) linux/4.15.0-66-generic.
  1082. Oct 27 20:18:10 localhost nfsdcltrack[958]: Failed to init database: -13
  1083. Oct 27 20:18:10 localhost kernel: [ 9.148299] NFSD: Using /var/lib/nfs/v4recovery as the NFSv4 state recovery directory
  1084. Oct 27 20:18:10 localhost kernel: [ 9.148554] NFSD: starting 90-second grace period (net f0000099)
  1085. Oct 27 20:18:10 localhost networkd-dispatcher[867]: No valid path found for iwconfig
  1086. Oct 27 20:18:10 localhost systemd[1]: Started NFS server and services.
  1087. Oct 27 20:18:10 localhost systemd[1]: Started Snappy daemon.
  1088. Oct 27 20:18:10 localhost systemd[1]: Starting Wait until snapd is fully seeded...
  1089. Oct 27 20:18:10 localhost systemd[1]: Started Dispatcher daemon for systemd-networkd.
  1090. Oct 27 20:18:10 localhost systemd[1]: Started Wait until snapd is fully seeded.
  1091. Oct 27 20:18:10 localhost systemd[1]: Started Disk Manager.
  1092. Oct 27 20:18:10 localhost udisksd[879]: Acquired the name org.freedesktop.UDisks2 on the system message bus
  1093. Oct 27 20:18:10 localhost udisksd[879]: Cleaning up mount point /media/vdr/3451-ADE2 (device 8:35 is not mounted)
  1094. Oct 27 20:18:10 localhost udisksd[879]: Cleaning up mount point /media/vdr/327B-9667 (device 8:33 is not mounted)
  1095. Oct 27 20:18:10 localhost mysqld[1076]: 2019-10-27 20:18:10 140054344481920 [Note] /usr/sbin/mysqld (mysqld 10.1.41-MariaDB-0ubuntu0.18.04.1) starting as process 1076 ...
  1096. Oct 27 20:18:10 localhost avahi-daemon[860]: Server startup complete. Host name is myVDR.local. Local service cookie is 1435830800.
  1097. Oct 27 20:18:11 localhost systemd-networkd[765]: enp5s0: Gained IPv6LL
  1098. Oct 27 20:18:11 localhost systemd-networkd[765]: enp5s0: Configured
  1099. Oct 27 20:18:11 localhost systemd-networkd-wait-online[791]: ignoring: lo
  1100. Oct 27 20:18:11 localhost systemd-networkd-wait-online[791]: managing: enp5s0
  1101. Oct 27 20:18:11 localhost systemd-timesyncd[762]: Network configuration changed, trying to establish connection.
  1102. Oct 27 20:18:11 localhost systemd[1]: Started Wait for Network to be Configured.
  1103. Oct 27 20:18:11 localhost systemd[1]: Reached target Network is Online.
  1104. Oct 27 20:18:11 localhost systemd[1]: Starting Postfix Mail Transport Agent (instance -)...
  1105. Oct 27 20:18:11 localhost systemd[1]: Starting Availability of block devices...
  1106. Oct 27 20:18:11 localhost systemd[1]: Reached target Remote File Systems (Pre).
  1107. Oct 27 20:18:11 localhost systemd[1]: Reached target Remote File Systems.
  1108. Oct 27 20:18:11 localhost systemd[1]: Starting LSB: automatic crash report generation...
  1109. Oct 27 20:18:11 localhost systemd[1]: Starting LSB: Adaptive readahead daemon...
  1110. Oct 27 20:18:11 localhost systemd[1]: Starting Permit User Sessions...
  1111. Oct 27 20:18:11 localhost systemd[1]: Starting Samba NMB Daemon...
  1112. Oct 27 20:18:11 localhost systemd[1]: Starting Automounts filesystems on demand...
  1113. Oct 27 20:18:11 localhost systemd[1]: Starting OpenBSD Secure Shell server...
  1114. Oct 27 20:18:11 localhost systemd[1]: Started Availability of block devices.
  1115. Oct 27 20:18:11 localhost systemd[1]: Started Permit User Sessions.
  1116. Oct 27 20:18:11 localhost systemd[1]: Starting Hold until boot process finishes up...
  1117. Oct 27 20:18:11 localhost systemd[1]: Starting Terminate Plymouth Boot Screen...
  1118. Oct 27 20:18:11 localhost systemd[1]: Received SIGRTMIN+21 from PID 280 (plymouthd).
  1119. Oct 27 20:18:11 localhost systemd[1]: Started Terminate Plymouth Boot Screen.
  1120. Oct 27 20:18:11 localhost systemd[1]: Started Hold until boot process finishes up.
  1121. Oct 27 20:18:11 localhost systemd[1]: Starting Set console scheme...
  1122. Oct 27 20:18:11 localhost systemd[1]: Starting X on vt7...
  1123. Oct 27 20:18:11 localhost systemd[1]: Started OpenBSD Secure Shell server.
  1124. Oct 27 20:18:11 localhost systemd[1]: Started Set console scheme.
  1125. Oct 27 20:18:11 localhost systemd[1]: Created slice system-getty.slice.
  1126. Oct 27 20:18:11 localhost systemd[1]: Started Getty on tty1.
  1127. Oct 27 20:18:11 localhost systemd[1]: Reached target Login Prompts.
  1128. Oct 27 20:18:11 localhost apport[1102]: * Starting automatic crash report generation: apport
  1129. Oct 27 20:18:11 localhost x-daemon[1147]: X.Org X Server 1.19.6
  1130. Oct 27 20:18:11 localhost x-daemon[1147]: Release Date: 2017-12-20
  1131. Oct 27 20:18:11 localhost x-daemon[1147]: X Protocol Version 11, Revision 0
  1132. Oct 27 20:18:11 localhost x-daemon[1147]: Build Operating System: Linux 4.4.0-148-generic x86_64 Ubuntu
  1133. Oct 27 20:18:11 localhost x-daemon[1147]: Current Operating System: Linux myVDR 4.15.0-66-generic #75-Ubuntu SMP Tue Oct 1 05:24:09 UTC 2019 x86_64
  1134. Oct 27 20:18:11 localhost x-daemon[1147]: Kernel command line: BOOT_IMAGE=/boot/vmlinuz-4.15.0-66-generic root=UUID=3a2488fb-8ae8-4722-b647-c95071d7e0af ro quiet splash vt.handoff=1
  1135. Oct 27 20:18:11 localhost x-daemon[1147]: Build Date: 03 June 2019 08:10:35AM
  1136. Oct 27 20:18:11 localhost x-daemon[1147]: xorg-server 2:1.19.6-1ubuntu4.3 (For technical support please see http://www.ubuntu.com/support)
  1137. Oct 27 20:18:11 localhost x-daemon[1147]: Current version of pixman: 0.34.0
  1138. Oct 27 20:18:11 localhost x-daemon[1147]: #011Before reporting problems, check http://wiki.x.org
  1139. Oct 27 20:18:11 localhost x-daemon[1147]: #011to make sure that you have the latest version.
  1140. Oct 27 20:18:11 localhost x-daemon[1147]: Markers: (--) probed, (**) from config file, (==) default setting,
  1141. Oct 27 20:18:11 localhost x-daemon[1147]: #011(++) from command line, (!!) notice, (II) informational,
  1142. Oct 27 20:18:11 localhost x-daemon[1147]: #011(WW) warning, (EE) error, (NI) not implemented, (??) unknown.
  1143. Oct 27 20:18:11 localhost x-daemon[1147]: (==) Log file: "/var/log/Xorg.0.log", Time: Sun Oct 27 20:18:11 2019
  1144. Oct 27 20:18:11 localhost x-daemon[1147]: (==) Using config file: "/etc/X11/xorg.conf"
  1145. Oct 27 20:18:11 localhost x-daemon[1147]: (==) Using config directory: "/etc/X11/xorg.conf.d"
  1146. Oct 27 20:18:11 localhost x-daemon[1147]: (==) Using system config directory "/usr/share/X11/xorg.conf.d"
  1147. Oct 27 20:18:11 localhost preload[1105]: * Starting Adaptive readahead daemon preload
  1148. Oct 27 20:18:11 localhost systemd[1]: Started Automounts filesystems on demand.
  1149. Oct 27 20:18:11 localhost systemd[1]: Started Avahi linker.
  1150. Oct 27 20:18:11 localhost systemd[1]: Started prevent-umount-on-pause.service.
  1151. Oct 27 20:18:11 localhost systemd[1]: Started vdr-update-monitor.
  1152. Oct 27 20:18:11 localhost apport[1102]: ...done.
  1153. Oct 27 20:18:11 localhost systemd[1]: Started LSB: automatic crash report generation.
  1154. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Video on myVDR" (/services/yavdr-video.service) successfully established.
  1155. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Recordings on myVDR" (/services/yavdr-recordings.service) successfully established.
  1156. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Pictures on myVDR" (/services/yavdr-pictures.service) successfully established.
  1157. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Files on myVDR" (/services/yavdr-files.service) successfully established.
  1158. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Backups on myVDR" (/services/yavdr-backups.service) successfully established.
  1159. Oct 27 20:18:11 localhost avahi-daemon[860]: Service "Audio on myVDR" (/services/yavdr-audio.service) successfully established.
  1160. Oct 27 20:18:11 localhost systemd[1]: Started Samba NMB Daemon.
  1161. Oct 27 20:18:11 localhost systemd[1]: Starting Samba SMB Daemon...
  1162. Oct 27 20:18:11 localhost preload[1105]: ...done.
  1163. Oct 27 20:18:11 localhost systemd[1]: Started LSB: Adaptive readahead daemon.
  1164. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,275 INFO Started avahi-linker
  1165. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,307 INFO skip local service 'Video on myVDR' type '_nfs._tcp' domain 'local'
  1166. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,307 INFO skip local service 'Recordings on myVDR' type '_nfs._tcp' domain 'local'
  1167. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Pictures on myVDR' type '_nfs._tcp' domain 'local'
  1168. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Files on myVDR' type '_nfs._tcp' domain 'local'
  1169. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Backups on myVDR' type '_nfs._tcp' domain 'local'
  1170. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Audio on myVDR' type '_nfs._tcp' domain 'local'
  1171. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Video on myVDR' type '_nfs._tcp' domain 'local'
  1172. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Recordings on myVDR' type '_nfs._tcp' domain 'local'
  1173. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,309 INFO skip local service 'Pictures on myVDR' type '_nfs._tcp' domain 'local'
  1174. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Files on myVDR' type '_nfs._tcp' domain 'local'
  1175. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Backups on myVDR' type '_nfs._tcp' domain 'local'
  1176. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Audio on myVDR' type '_nfs._tcp' domain 'local'
  1177. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Video on myVDR' type '_nfs._tcp' domain 'local'
  1178. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Recordings on myVDR' type '_nfs._tcp' domain 'local'
  1179. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Pictures on myVDR' type '_nfs._tcp' domain 'local'
  1180. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Files on myVDR' type '_nfs._tcp' domain 'local'
  1181. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,310 INFO skip local service 'Backups on myVDR' type '_nfs._tcp' domain 'local'
  1182. Oct 27 20:18:12 localhost avahi-linker[1162]: 2019-10-27 20:18:12,311 INFO skip local service 'Audio on myVDR' type '_nfs._tcp' domain 'local'
  1183. Oct 27 20:18:12 localhost kernel: [ 11.128854] resource sanity check: requesting [mem 0x000c0000-0x000fffff], which spans more than PCI Bus 0000:00 [mem 0x000c0000-0x000dffff window]
  1184. Oct 27 20:18:12 localhost kernel: [ 11.129108] caller os_map_kernel_space.part.8+0x10b/0x150 [nvidia] mapping multiple BARs
  1185. Oct 27 20:18:12 localhost systemd[1]: Started Samba SMB Daemon.
  1186. Oct 27 20:18:12 localhost systemd[1]: Starting NVIDIA Persistence Daemon...
  1187. Oct 27 20:18:12 localhost systemd[1]: Started NVIDIA Persistence Daemon.
  1188. Oct 27 20:18:12 localhost nvidia-persistenced: Verbose syslog connection opened
  1189. Oct 27 20:18:12 localhost nvidia-persistenced: Now running with user ID 111 and group ID 116
  1190. Oct 27 20:18:12 localhost nvidia-persistenced: Started (1549)
  1191. Oct 27 20:18:12 localhost nvidia-persistenced: device 0000:01:00.0 - registered
  1192. Oct 27 20:18:12 localhost nvidia-persistenced: Local RPC service initialized
  1193. Oct 27 20:18:12 localhost systemd[1]: Started ACPI event daemon.
  1194. Oct 27 20:18:12 localhost acpid: starting up with netlink and the input layer
  1195. Oct 27 20:18:12 localhost acpid: 0 rules loaded
  1196. Oct 27 20:18:12 localhost acpid: waiting for events: event logging is off
  1197. Oct 27 20:18:12 localhost acpid: client connected from 1149[0:0]
  1198. Oct 27 20:18:12 localhost acpid: 1 client rule loaded
  1199. Oct 27 20:18:13 localhost systemd[1]: Started X on vt7.
  1200. Oct 27 20:18:13 localhost systemd[1]: Starting Video Disk Recorder...
  1201. Oct 27 20:18:13 localhost systemd[1]: Started Direct X login for user vdr.
  1202. Oct 27 20:18:13 localhost systemd[1]: Starting Start a X session and a systemd user session for the vdr user...
  1203. Oct 27 20:18:13 localhost systemd[1]: Started Start a X session and a systemd user session for the vdr user.
  1204. Oct 27 20:18:13 localhost systemd[1]: Created slice User Slice of vdr.
  1205. Oct 27 20:18:13 localhost systemd[1]: Starting User Manager for UID 666...
  1206. Oct 27 20:18:13 localhost systemd[1]: Started Session 1 of user vdr.
  1207. Oct 27 20:18:13 localhost vdr: [1799] VDR version 2.4.0 started
  1208. Oct 27 20:18:13 localhost vdr: [1799] switched to user 'vdr'
  1209. Oct 27 20:18:13 localhost vdr: [1799] codeset is 'UTF-8' - known
  1210. Oct 27 20:18:13 localhost systemd[1773]: Starting D-Bus User Message Bus Socket.
  1211. Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent (ssh-agent emulation).
  1212. Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent and passphrase cache (access for web browsers).
  1213. Oct 27 20:18:13 localhost systemd[1773]: Listening on Sound System.
  1214. Oct 27 20:18:13 localhost systemd[1773]: Reached target Timers.
  1215. Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent and passphrase cache.
  1216. Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG network certificate management daemon.
  1217. Oct 27 20:18:13 localhost systemd[1773]: Listening on GnuPG cryptographic agent and passphrase cache (restricted).
  1218. Oct 27 20:18:13 localhost systemd[1773]: Reached target Paths.
  1219. Oct 27 20:18:13 localhost systemd[1773]: Listening on D-Bus User Message Bus Socket.
  1220. Oct 27 20:18:13 localhost systemd[1773]: Reached target Sockets.
  1221. Oct 27 20:18:13 localhost systemd[1773]: Reached target Basic System.
  1222. Oct 27 20:18:13 localhost systemd[1]: Started User Manager for UID 666.
  1223. Oct 27 20:18:13 localhost systemd[1773]: Started exit window manager gracefully.
  1224. Oct 27 20:18:13 localhost systemd[1773]: Starting Start tmux in detached session...
  1225. Oct 27 20:18:13 localhost systemd[1773]: Starting Sound Service...
  1226. Oct 27 20:18:13 localhost systemd[1773]: Started Start tmux in detached session.
  1227. Oct 27 20:18:13 localhost systemd[1773]: Started D-Bus User Message Bus.
  1228. Oct 27 20:18:13 localhost dbus-daemon[1864]: [session uid=666 pid=1864] AppArmor D-Bus mediation is enabled
  1229. Oct 27 20:18:13 localhost postfix/postfix-script[1872]: starting the Postfix mail system
  1230. Oct 27 20:18:13 localhost vdr: [1799] found 28 locales in /usr/share/locale
  1231. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-dvbapi.so.2.4.0
  1232. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-conflictcheckonly.so.2.4.0
  1233. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-dbus2vdr.so.2.4.0
  1234. Oct 27 20:18:13 localhost vdr: [1799] dbus2vdr: use shutdown-hooks in /usr/share/vdr/shutdown-hooks
  1235. Oct 27 20:18:13 localhost vdr: [1799] dbus2vdr: use shutdown-hooks-wrapper /usr/share/vdr-plugin-dbus2vdr/shutdown-wrapper
  1236. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-desktop.so.2.4.0
  1237. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-devstatus.so.2.4.0
  1238. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-epg2vdr.so.2.4.0
  1239. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-epgsearch.so.2.4.0
  1240. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-epgsearchonly.so.2.4.0
  1241. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-live.so.2.4.0
  1242. Oct 27 20:18:13 localhost vdr: [1799] [live] INFO: validating server ip '0.0.0.0'
  1243. Oct 27 20:18:13 localhost vdr[1799]: INFO: validating live server ip '0.0.0.0'
  1244. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-markad.so.2.4.0
  1245. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-menuorg.so.2.4.0
  1246. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-osd2web.so.2.4.0
  1247. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-osdteletext.so.2.4.0
  1248. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-pulsecontrol.so.2.4.0
  1249. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-quickepgsearch.so.2.4.0
  1250. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-scraper2vdr.so.2.4.0
  1251. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-skindesigner.so.2.4.0
  1252. Oct 27 20:18:13 localhost postfix/master[1876]: daemon started -- version 3.3.0, configuration /etc/postfix
  1253. Oct 27 20:18:13 localhost systemd[1]: Started Postfix Mail Transport Agent (instance -).
  1254. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-softhddevice.so.2.4.0
  1255. Oct 27 20:18:13 localhost systemd[1]: Starting Postfix Mail Transport Agent...
  1256. Oct 27 20:18:13 localhost systemd[1]: Started Postfix Mail Transport Agent.
  1257. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-streamdev-server.so.2.4.0
  1258. Oct 27 20:18:13 localhost vdr: [1799] loading plugin: /usr/lib/vdr/plugins/libvdr-wirbelscan.so.2.4.0
  1259. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/setup.conf
  1260. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/sources.conf
  1261. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/diseqc.conf
  1262. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/scr.conf
  1263. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/channels.conf
  1264. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/timers.conf
  1265. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/commands.conf
  1266. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/reccmds.conf
  1267. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/svdrphosts.conf
  1268. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/remote.conf
  1269. Oct 27 20:18:13 localhost vdr: [1799] loading /var/lib/vdr/keymacros.conf
  1270. Oct 27 20:18:13 localhost vdr: [1799] ERROR: unknown plugin 'xineliboutput'
  1271. Oct 27 20:18:13 localhost vdr: [1907] video directory scanner thread started (pid=1799, tid=1907, prio=low)
  1272. Oct 27 20:18:13 localhost vdr: [1908] epg data reader thread started (pid=1799, tid=1908, prio=high)
  1273. Oct 27 20:18:13 localhost vdr: [1908] reading EPG data from /var/cache/vdr/epg.data
  1274. Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'A - ATSC'
  1275. Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'C - DVB-C'
  1276. Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'S - DVB-S'
  1277. Oct 27 20:18:13 localhost vdr: [1799] registered source parameters for 'T - DVB-T'
  1278. Oct 27 20:18:13 localhost vdr: [1799] probing /dev/dvb/adapter0/frontend0
  1279. Oct 27 20:18:13 localhost vdr: [1799] creating cDvbDevice
  1280. Oct 27 20:18:13 localhost vdr: [1799] new device number 1
  1281. Oct 27 20:18:13 localhost bash[1749]: Openbox-Message: Keine gültige Menü-Datei "/var/lib/openbox/debian-menu.xml" vorhanden
  1282. Oct 27 20:18:13 localhost vdr: [1799] DVB API version is 0x050A (VDR was built with 0x050A)
  1283. Oct 27 20:18:13 localhost vdr: [1799] frontend 0/0 provides DVB-S,DVB-S2,DSS with QPSK ("STB0899 Multistandard")
  1284. Oct 27 20:18:13 localhost vdr: [1799] cTimeMs: using monotonic clock (resolution is 1 ns)
  1285. Oct 27 20:18:13 localhost vdr: [1799] probing /dev/dvb/adapter1/frontend0
  1286. Oct 27 20:18:13 localhost vdr: [1799] creating cDvbDevice
  1287. Oct 27 20:18:13 localhost vdr: [1799] new device number 2
  1288. Oct 27 20:18:13 localhost vdr: [1920] frontend 0/0 tuner thread started (pid=1799, tid=1920, prio=high)
  1289. Oct 27 20:18:13 localhost vdr: [1921] device 1 section handler thread started (pid=1799, tid=1921, prio=low)
  1290. Oct 27 20:18:14 localhost systemd[1773]: Reloading.
  1291. Oct 27 20:18:14 localhost vdr: [1799] frontend 1/0 provides DVB-S,DVB-S2,DSS with QPSK ("STB0899 Multistandard")
  1292. Oct 27 20:18:14 localhost vdr: [1799] found 2 DVB devices
  1293. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: dvbapi (2.2.5): SoftCAM für OSCam
  1294. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: conflictcheckonly (0.0.1): Direkter Zugriff auf epgsearch's Konflikt-Prüfungs-Menü
  1295. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: dbus2vdr (31): Steuerung des VDR über D-Bus
  1296. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: desktop (0.0.3): desktop apps menu
  1297. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: devstatus (0.4.1): DVB-Gerätestatus
  1298. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: epg2vdr (1.1.98-GIT): epg2vdr plugin
  1299. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: epgsearch (2.4.0): Suche im EPG nach Wiederholungen und anderem
  1300. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: epgsearchonly (0.0.1): Direkter Zugriff auf epgsearch's Suchenmenu
  1301. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: live (2.3.1): Live Interactive VDR Environment
  1302. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: markad (0.1.6): Markiere Werbung
  1303. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: menuorg (0.5.2): Reorganisiert das Haupmenü
  1304. Oct 27 20:18:14 localhost vdr: [1799] loading menuorg config file from /var/lib/vdr/plugins/menuorg.xml
  1305. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: osd2web (0.2.48-GIT): osd2web plugin
  1306. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: osdteletext (0.9.7): Zeigt den Videotext auf dem OSD an
  1307. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: pulsecontrol (0.2.1): Pulseaudio über das OSD steuern
  1308. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: quickepgsearch (0.0.1): Schnelle Suche nach Sendungen
  1309. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: scraper2vdr (1.0.11-GIT): 'scraper2vdr' plugin
  1310. Oct 27 20:18:14 localhost vdr: scraper2vdr: using image directory /var/cache/vdr/epgimages/
  1311. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: skindesigner (1.2.8): Skin Designer
  1312. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: softhddevice (0.6.1rc1): Ein Software und GPU emulieres HD-Gerät
  1313. Oct 27 20:18:14 localhost vdr: [1799] new device number 3
  1314. Oct 27 20:18:14 localhost vdr: [1932] device 2 section handler thread started (pid=1799, tid=1932, prio=low)
  1315. Oct 27 20:18:14 localhost vdr: [1931] frontend 1/0 tuner thread started (pid=1799, tid=1931, prio=high)
  1316. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: streamdev-server (0.6.1-git): VDR Streaming Server
  1317. Oct 27 20:18:14 localhost vdr: [1799] initializing plugin: wirbelscan (2017.06.04): DVB channel scan for VDR
  1318. Oct 27 20:18:14 localhost vdr: [1799] setting primary device to 3
  1319. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]MakePrimaryDevice: 1
  1320. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]stopping OpenGL Worker Thread
  1321. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]OpenGL Worker Thread stopped
  1322. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]SetVideoFormat: 1
  1323. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1324. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1325. Oct 27 20:18:14 localhost vdr: [1799] [softhddev]SetVolumeDevice: 55
  1326. Oct 27 20:18:14 localhost vdr: [1799] assuming manual start of VDR
  1327. Oct 27 20:18:14 localhost vdr: [1799] skin "mynew_estuary" not available - using "lcars" instead
  1328. Oct 27 20:18:14 localhost vdr: [1799] loading /var/lib/vdr/themes/lcars-default.theme
  1329. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: dvbapi
  1330. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: plugin version 2.2.5 initializing (VDR 2.4.0)
  1331. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: decryption library: libdvbcsa
  1332. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: Creating sCCIAdapter
  1333. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: Creating SCCAMSlot for device 1
  1334. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: Creating SCCAMSlot for device 2
  1335. Oct 27 20:18:14 localhost vdr: [1799] DVBAPI: plugin started
  1336. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: conflictcheckonly
  1337. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: dbus2vdr
  1338. Oct 27 20:18:14 localhost vdr: [1934] Socket Handler thread started (pid=1799, tid=1934, prio=high)
  1339. Oct 27 20:18:14 localhost vdr: [1937] dbus2vdr: mainloop started
  1340. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: desktop
  1341. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: devstatus
  1342. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: epg2vdr
  1343. Oct 27 20:18:14 localhost vdr: epg2vdr: Info: Calling mysql_library_init()
  1344. Oct 27 20:18:14 localhost vdr: epg2vdr: Set locale to 'de_AT.UTF-8'
  1345. Oct 27 20:18:14 localhost vdr: epg2vdr: detected UTF-8
  1346. Oct 27 20:18:14 localhost vdr: epg2vdr: Dictionary '/var/lib/vdr/plugins/epg2vdr//epg.dat' loaded
  1347. Oct 27 20:18:14 localhost vdr: [1936] SC-CI adapter thread started (pid=1799, tid=1936, prio=high)
  1348. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: epgsearch
  1349. Oct 27 20:18:14 localhost vdr: [1799] loading /var/lib/vdr/plugins/epgsearch/epgsearchcats.conf
  1350. Oct 27 20:18:14 localhost vdr: [1799] loading /var/lib/vdr/plugins/epgsearch/epgsearchmenu.conf
  1351. Oct 27 20:18:14 localhost vdr: [1940] epg2vdr-update thread started (pid=1799, tid=1940, prio=high)
  1352. Oct 27 20:18:14 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
  1353. Oct 27 20:18:14 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
  1354. Oct 27 20:18:14 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open vdrs)
  1355. Oct 27 20:18:14 localhost vdr: [1937] dbus2vdr: System: connected with unique name :1.30
  1356. Oct 27 20:18:14 localhost vdr: [1937] dbus2vdr: thread-pool for handling signal-emits started
  1357. Oct 27 20:18:14 localhost avahi-linker[1162]: 2019-10-27 20:18:14,142 INFO VDR started
  1358. Oct 27 20:18:14 localhost systemd[1773]: Reloading.
  1359. Oct 27 20:18:14 localhost systemd[1773]: message repeated 4 times: [ Reloading.]
  1360. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 0.0: doReply changed, reset triggered
  1361. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 0.0: now using CAIDs version 1
  1362. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 0.0: status 'present'
  1363. Oct 27 20:18:14 localhost vdr: [1936] CAM 1: module present
  1364. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 1.1: doReply changed, reset triggered
  1365. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 1.1: now using CAIDs version 1
  1366. Oct 27 20:18:14 localhost vdr: [1936] DVBAPI: 1.1: status 'present'
  1367. Oct 27 20:18:14 localhost vdr: [1936] CAM 2: module present
  1368. Oct 27 20:18:14 localhost systemd[1773]: Reloading.
  1369. Oct 27 20:18:14 localhost systemd[1773]: message repeated 2 times: [ Reloading.]
  1370. Oct 27 20:18:14 localhost set-cpufreq[873]: Setting powersave scheduler for all CPUs
  1371. Oct 27 20:18:14 localhost systemd[1773]: Started Sound Service.
  1372. Oct 27 20:18:14 localhost systemd[1773]: Reached target Default.
  1373. Oct 27 20:18:14 localhost systemd[1773]: Startup finished in 1.830s.
  1374. Oct 27 20:18:14 localhost vdr: [1908] epg data reader thread ended (pid=1799, tid=1908)
  1375. Oct 27 20:18:14 localhost systemd[1773]: Started LIRC command handler.
  1376. Oct 27 20:18:14 localhost systemd[1773]: Starting Detect second DISPLAY using xrandr...
  1377. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: epgsearchonly
  1378. Oct 27 20:18:14 localhost vdr: [2046] EPGSearch: conflictcheck thread started (pid=1799, tid=2046, prio=high)
  1379. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: live
  1380. Oct 27 20:18:14 localhost vdr: [1799] LIVE: initial file cache has 82 entries and needs 376715 bytes of data!
  1381. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: markad
  1382. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: menuorg
  1383. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: osd2web
  1384. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: osdteletext
  1385. Oct 27 20:18:14 localhost vdr: osd2web: osd2web plugin thread started (pid=1799)
  1386. Oct 27 20:18:14 localhost vdr: [1799] OSD-Teletext: Error statfs'ing root directory "/run/shm/vtx": Datei oder Verzeichnis nicht gefunden, cache size uncontrolled
  1387. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: pulsecontrol
  1388. Oct 27 20:18:14 localhost vdr: [2047] [live] INFO: attempt to listen on ip = '0.0.0.0'
  1389. Oct 27 20:18:14 localhost vdr[1799]: vdr: error while reading '/var/lib/vdr/plugins/pulsecontrol/startup.script'
  1390. Oct 27 20:18:14 localhost vdr: [1799] pulsecontrol: error on reading script /var/lib/vdr/plugins/pulsecontrol/startup.script
  1391. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: quickepgsearch
  1392. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: scraper2vdr
  1393. Oct 27 20:18:14 localhost vdr: epg2vdr: Info: Skipping calling mysql_library_init(), it's already done!
  1394. Oct 27 20:18:14 localhost vdr: scraper2vdr: Set locale to 'de_AT.UTF-8'
  1395. Oct 27 20:18:14 localhost vdr: scraper2vdr: detected UTF-8
  1396. Oct 27 20:18:14 localhost vdr: osd2web: Listener at port (4444) established
  1397. Oct 27 20:18:14 localhost vdr: osd2web: using libwebsocket version '2.4.1 unknown-build-hash'
  1398. Oct 27 20:18:14 localhost vdr: [2047] [live] ERROR: Unable to load cert/key (/var/lib/vdr/plugins/live/live.pem//var/lib/vdr/plugins/live/live-key.pem): Datei oder Verzeichnis nicht gefunden
  1399. Oct 27 20:18:14 localhost vdr: scraper2vdr: Dictionary '/var/lib/vdr/plugins/scraper2vdr/epg.dat' loaded
  1400. Oct 27 20:18:14 localhost vdr: [1799] starting plugin: skindesigner
  1401. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: TrueColor OSD found
  1402. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using libskindesigner API Version 0.1.2
  1403. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: plugin setup uses libskindesigner API Version 0.1.2
  1404. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: plugin setup has registered 1 menus
  1405. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: skinsetup template successfully registered at skindesigner, id 0
  1406. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using Skin Directory /usr/share/vdr/plugins/skindesigner/skins/
  1407. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using Installer Skin Directory /var/lib/vdr/plugins/skindesigner/installerskins/
  1408. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using common ChannelLogo Directory /usr/share/vdr/plugins/skindesigner/logos/
  1409. Oct 27 20:18:14 localhost vdr: [1799] skindesigner: using EPG Images Directory /var/cache/vdr/epgimages/
  1410. Oct 27 20:18:14 localhost vdr: [1799] skindesigner 3 skins found in /usr/share/vdr/plugins/skindesigner/skins/
  1411. Oct 27 20:18:14 localhost vdr: [2057] scraper2vdr-update thread started (pid=1799, tid=2057, prio=low)
  1412. Oct 27 20:18:14 localhost vdr: [1799] skindesigner 0 skins found in /var/lib/vdr/plugins/skindesigner/installerskins/
  1413. Oct 27 20:18:14 localhost detect-second-display[2043]: Can't open display :0.1
  1414. Oct 27 20:18:14 localhost systemd[1773]: Started Detect second DISPLAY using xrandr.
  1415. Oct 27 20:18:14 localhost systemd[1773]: Started manage VDR frontends.
  1416. Oct 27 20:18:14 localhost systemd[1773]: Reached target yaVDR Desktop.
  1417. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: skin mynew_estuary started
  1418. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: skin estuary4vdr started
  1419. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: skin metrixhd started
  1420. Oct 27 20:18:15 localhost vdr: [1799] starting plugin: softhddevice
  1421. Oct 27 20:18:15 localhost vdr: [softhddev] ready detached
  1422. Oct 27 20:18:15 localhost vdr: [1799] starting plugin: streamdev-server
  1423. Oct 27 20:18:15 localhost vdr: [1799] loading /var/lib/vdr/plugins/streamdev-server/streamdevhosts.conf
  1424. Oct 27 20:18:15 localhost vdr: [1799] starting plugin: wirbelscan
  1425. Oct 27 20:18:15 localhost vdr: [2064] streamdev server thread started (pid=1799, tid=2064, prio=high)
  1426. Oct 27 20:18:15 localhost vdr: [2064] Streamdev: Listening (VTP) on port 2004
  1427. Oct 27 20:18:15 localhost vdr: [2064] Streamdev: Listening (HTTP) on port 3000
  1428. Oct 27 20:18:15 localhost vdr: [1799] setting current skin to "mynew_estuary"
  1429. Oct 27 20:18:15 localhost vdr: [1799] loading /var/lib/vdr/themes/mynew_estuary-default.theme
  1430. Oct 27 20:18:15 localhost vdr: [1799] remote control LIRC - keys known
  1431. Oct 27 20:18:15 localhost vdr: [2065] LIRC remote control thread started (pid=1799, tid=2065, prio=high)
  1432. Oct 27 20:18:15 localhost vdr: [1799] loading /var/cache/vdr/cam.data
  1433. Oct 27 20:18:15 localhost bash[1749]: ERROR: openbox-xdg-autostart requires PyXDG to be installed
  1434. Oct 27 20:18:15 localhost vdr: [1799] DVBAPI: 0.0: status 'reset'
  1435. Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: 0.0: status 'ready'
  1436. Oct 27 20:18:15 localhost vdr: [1936] CAM 1: module ready
  1437. Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: 1.1: status 'reset'
  1438. Oct 27 20:18:15 localhost vdr: [1936] CAM 2: module reset
  1439. Oct 27 20:18:15 localhost vdr: [1799] DVBAPI: 1.1: status 'ready'
  1440. Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: CaInfo: 0.0 sending CA info
  1441. Oct 27 20:18:15 localhost vdr: [1936] CAM 1: system ids: FFFF
  1442. Oct 27 20:18:15 localhost vdr: [1936] CAM 1: replies to QUERY - multi channel decryption (MCD) possible
  1443. Oct 27 20:18:15 localhost bash[1749]: Typelib for 'libnotify' is not available. Possible causes include:
  1444. Oct 27 20:18:15 localhost bash[1749]: #011- libnotify is not installed
  1445. Oct 27 20:18:15 localhost bash[1749]: #011- the typelib is provided by a separate package
  1446. Oct 27 20:18:15 localhost bash[1749]: #011- libnotify was built with introspection disabled
  1447. Oct 27 20:18:15 localhost bash[1749]: Starting udiskie without notifications.
  1448. Oct 27 20:18:15 localhost snapd[874]: daemon.go:576: gracefully waiting for running hooks
  1449. Oct 27 20:18:15 localhost snapd[874]: daemon.go:578: done waiting for running hooks
  1450. Oct 27 20:18:15 localhost snapd[874]: daemon stop requested to wait for socket activation
  1451. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:yaVDRFrontend:init lirc connection on /var/run/lirc/lircd
  1452. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:init VDRFrontend with name 'VDR-Frontend and fe_typevdr'
  1453. Oct 27 20:18:15 localhost kernel: [ 14.319470] FAT-fs (sdc1): Volume was not properly unmounted. Some data may be corrupt. Please run fsck.
  1454. Oct 27 20:18:15 localhost kernel: [ 14.341696] FAT-fs (sdc3): Volume was not properly unmounted. Some data may be corrupt. Please run fsck.
  1455. Oct 27 20:18:15 localhost yavdr-frontend[2061]: INFO:pydbus2vdr:VDR Status: running
  1456. Oct 27 20:18:15 localhost vdr: [1937] dbus2vdr: thread-pool for handling method-calls started
  1457. Oct 27 20:18:15 localhost systemd[1]: Created slice system-clean\x2dmount\x2dpoint.slice.
  1458. Oct 27 20:18:15 localhost systemd[1]: Started Clean the /media/vdr/3451-ADE2 mount point.
  1459. Oct 27 20:18:15 localhost systemd[1]: Started Clean the /media/vdr/327B-9667 mount point.
  1460. Oct 27 20:18:15 localhost udisksd[879]: Mounted /dev/sdc3 at /media/vdr/3451-ADE2 on behalf of uid 666
  1461. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:init SystemdUnit with name: kodi and fe_type: unit
  1462. Oct 27 20:18:15 localhost bash[1749]: mounted /org/freedesktop/UDisks2/block_devices/sdc3 on /media/vdr/3451-ADE2
  1463. Oct 27 20:18:15 localhost udisksd[879]: Mounted /dev/sdc1 at /media/vdr/327B-9667 on behalf of uid 666
  1464. Oct 27 20:18:15 localhost bash[1749]: mounted /org/freedesktop/UDisks2/block_devices/sdc1 on /media/vdr/327B-9667
  1465. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:set_unit_name: kodi.service
  1466. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:init SystemdUnit with name: firefox and fe_type: app
  1467. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:set_unit_name: app@firefox.service
  1468. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:init SystemdUnit with name: debian-xterm.desktop and fe_type: app
  1469. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:SystemdUnitFrontend:set_unit_name: app@debian\x2dxterm.desktop.service
  1470. Oct 27 20:18:15 localhost yavdr-frontend[2061]: DEBUG:yaVDRFrontend:set_background with options path: /usr/share/yavdr/images/yavdr_logo.png, fill: False
  1471. Oct 27 20:18:15 localhost vdr: [1936] CAM 2: module ready
  1472. Oct 27 20:18:15 localhost vdr: [1936] DVBAPI: CaInfo: 1.1 sending CA info
  1473. Oct 27 20:18:15 localhost vdr: [1936] CAM 2: system ids: FFFF
  1474. Oct 27 20:18:15 localhost vdr: [1799] CAM 1: ready, master (OSCam)
  1475. Oct 27 20:18:15 localhost vdr: [1799] CAM 2: ready, slave of CAM 1
  1476. Oct 27 20:18:15 localhost vdr: [1799] switching to channel 36 S19.2E-1-1089-12080 (RTLplus)
  1477. Oct 27 20:18:15 localhost vdr: [1799] creating directory /run/shm/vtx
  1478. Oct 27 20:18:15 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1089-12080
  1479. Oct 27 20:18:15 localhost systemd[1]: Started Video Disk Recorder.
  1480. Oct 27 20:18:15 localhost vdr: [1799] [softhddev]SetVolumeDevice: 55
  1481. Oct 27 20:18:15 localhost vdr: [2112] SVDRP server handler thread started (pid=1799, tid=2112, prio=low)
  1482. Oct 27 20:18:15 localhost vdr: [2112] SVDRP myVDR opening port 6419/tcp
  1483. Oct 27 20:18:15 localhost systemd[1]: Started vdr-net-monitor.
  1484. Oct 27 20:18:15 localhost vdr: [2112] SVDRP myVDR listening on port 6419/tcp
  1485. Oct 27 20:18:15 localhost vdr: [2108] device 1 receiver thread started (pid=1799, tid=2108, prio=high)
  1486. Oct 27 20:18:15 localhost vdr: [2111] osdteletext-receiver thread started (pid=1799, tid=2111, prio=high)
  1487. Oct 27 20:18:15 localhost vdr: [2114] device 1 TS buffer thread started (pid=1799, tid=2114, prio=high)
  1488. Oct 27 20:18:15 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1489. Oct 27 20:18:15 localhost vdr: [2124] SVDRP client handler thread started (pid=1799, tid=2124, prio=low)
  1490. Oct 27 20:18:15 localhost vdr: [2124] SVDRP myVDR opening port 6419/udp
  1491. Oct 27 20:18:15 localhost vdr: [2124] SVDRP myVDR listening on port 6419/udp
  1492. Oct 27 20:18:15 localhost vdr: [2124] SVDRP myVDR > 255.255.255.255:6419 send dgram 'SVDRP:discover name:myVDR port:6419 vdrversion:20400 apiversion:20400 timeout:300'
  1493. Oct 27 20:18:15 localhost vdr: [1799] OSD size changed to 1920x1080 @ 1
  1494. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: initializing skin mynew_estuary
  1495. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using decimal point ,
  1496. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using channel logo path /usr/share/vdr/plugins/skindesigner/logos/
  1497. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using icon path /usr/share/vdr/plugins/skindesigner/skins/mynew_estuary/themes/default/
  1498. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using skinparts path /usr/share/vdr/plugins/skindesigner/skins/mynew_estuary/themes/default/skinparts/
  1499. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using svgtemplate path /usr/share/vdr/plugins/skindesigner/skins/mynew_estuary/svgtemplates/
  1500. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: using language de_DE
  1501. Oct 27 20:18:15 localhost mount-notification: event: device_mounted, device: /dev/sdc1, mount_path: /media/vdr/327B-9667
  1502. Oct 27 20:18:15 localhost mount-notification: event: device_mounted, device: /dev/sdc3, mount_path: /media/vdr/3451-ADE2
  1503. Oct 27 20:18:15 localhost bash[1749]: ln: Die symbolische Verknüpfung '/srv/vdr/video/327B-9667' konnte nicht angelegt werden: Die Datei existiert bereits
  1504. Oct 27 20:18:15 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
  1505. Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
  1506. Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open timers)
  1507. Oct 27 20:18:15 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
  1508. Oct 27 20:18:15 localhost bash[1749]: ln: Die symbolische Verknüpfung '/srv/vdr/video/3451-ADE2' konnte nicht angelegt werden: Die Datei existiert bereits
  1509. Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
  1510. Oct 27 20:18:15 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open timers)
  1511. Oct 27 20:18:15 localhost vdr recordings found: mountpoint already exists, aborting
  1512. Oct 27 20:18:15 localhost vdr recordings found: mountpoint already exists, aborting
  1513. Oct 27 20:18:15 localhost vdr: [1799] skindesigner: templates successfully validated and parsed
  1514. Oct 27 20:18:15 localhost vdr: [1799] [softhddev]detached - OpenGl Worker Thread not tried to start
  1515. Oct 27 20:18:19 localhost vdr: message repeated 31 times: [ [1799] [softhddev]detached - OpenGl Worker Thread not tried to start]
  1516. Oct 27 20:18:20 localhost vdr: [1907] video directory scanner thread ended (pid=1799, tid=1907)
  1517. Oct 27 20:18:20 localhost vdr: [1799] [softhddev]detached - OpenGl Worker Thread not tried to start
  1518. Oct 27 20:18:21 localhost vdr: message repeated 49 times: [ [1799] [softhddev]detached - OpenGl Worker Thread not tried to start]
  1519. Oct 27 20:18:21 localhost vdr: [1799] skindesigner: templates and images cached
  1520. Oct 27 20:18:21 localhost vdr: [1799] skindesigner: cached 71 icons - size internal mem 1,79MB, high level mem 0,00MB
  1521. Oct 27 20:18:21 localhost vdr: [1799] skindesigner: cached 601 logos - size 30943,06MB internal mem
  1522. Oct 27 20:18:21 localhost vdr: [1799] skindesigner: cached 11 skinparts - size internal mem 21,89MB, high level mem 0,00MB
  1523. Oct 27 20:18:21 localhost vdr: [1799] skindesigner: templates loaded and caches created - needed 5587 ms
  1524. Oct 27 20:18:21 localhost vdr: [1799] [softhddev]CreateOsd: left 0, top 0, level 0, using OpenGL OSD support
  1525. Oct 27 20:18:21 localhost vdr: [1799] [softhddev]detached - OpenGl Worker Thread not tried to start
  1526. Oct 27 20:18:21 localhost vdr: [1799] [softhddev]OpenGl Thread not started successfully, using Dummy OSD
  1527. Oct 27 20:18:21 localhost vdr: epg2vdr: Error, connecting to database at 'localhost' on port (3306) failed
  1528. Oct 27 20:18:21 localhost vdr: epg2vdr: Could not access database 'localhost:3306'
  1529. Oct 27 20:18:21 localhost vdr: epg2vdr: Could not access database 'localhost:3306' (tried to open timers)
  1530. Oct 27 20:18:21 localhost vdr: [2223] animator thread thread started (pid=1799, tid=2223, prio=high)
  1531. Oct 27 20:18:21 localhost yavdr-frontend[2061]: INFO:pydbus2vdr:VDR Status: running
  1532. Oct 27 20:18:21 localhost vdr: [2224] dbus2vdr: use of deprecated interface: 'List' should be called with the interface 'de.tvdr.vdr.pluginmanager'!
  1533. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:False
  1534. Oct 27 20:18:21 localhost yavdr-frontend[2061]: INFO:softhddevice:use_pasuspend is False
  1535. Oct 27 20:18:21 localhost avahi-linker[1162]: 2019-10-27 20:18:21,466 INFO Update recdir via dbus: 0 update of recordings triggered
  1536. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:could not read /var/cache/vdr/acpiwakeup.time: [Errno 2] No such file or directory: '/var/cache/vdr/acpiwakeup.time'
  1537. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:start_t has value StartType.MANUAL
  1538. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:attach_on_startup has value auto
  1539. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:yaVDRFrontend:set_background with options path: /usr/share/yavdr/images/yavdr_logo.png, fill: False
  1540. Oct 27 20:18:21 localhost vdr: [2226] video directory scanner thread started (pid=1799, tid=2226, prio=low)
  1541. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:VDRFrontend:user is active: True
  1542. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:check_state(): got status code: 912
  1543. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:status: softhddevice is detached
  1544. Oct 27 20:18:21 localhost yavdr-frontend[2061]: DEBUG:softhddevice:check_state(): got status code: 912
  1545. Oct 27 20:18:21 localhost vdr: [2226] video directory scanner thread ended (pid=1799, tid=2226)
  1546. Oct 27 20:18:21 localhost vdr: video/vdpau: VDPAU API version: 1
  1547. Oct 27 20:18:21 localhost vdr: video/vdpau: VDPAU information: NVIDIA VDPAU Driver Shared Library 390.116 Sun Jan 27 06:28:58 PST 2019
  1548. Oct 27 20:18:21 localhost vdr: video/vdpau: highest supported high quality scaling 1
  1549. Oct 27 20:18:21 localhost vdr: video/vdpau: feature deinterlace temporal supported
  1550. Oct 27 20:18:21 localhost vdr: video/vdpau: feature deinterlace temporal spatial supported
  1551. Oct 27 20:18:21 localhost vdr: video/vdpau: attribute skip chroma deinterlace supported
  1552. Oct 27 20:18:21 localhost vdr: video/vdpau: 4:2:0 chroma format with 4096x4096 supported
  1553. Oct 27 20:18:21 localhost vdr: video/vdpau: 4:2:2 chroma format with 4096x4096 supported
  1554. Oct 27 20:18:21 localhost vdr: video/vdpau: 8bit BGRA format with 16384x16384 supported
  1555. Oct 27 20:18:21 localhost vdr: video/vdpau: 10bit RGBA format with 16384x16384 supported
  1556. Oct 27 20:18:21 localhost vdr: audio: 'alsa' output module used
  1557. Oct 27 20:18:21 localhost vdr: audio/alsa: supports pause: yes
  1558. Oct 27 20:18:21 localhost vdr: [2046] EPGSearch: timer conflict check started
  1559. Oct 27 20:18:21 localhost vdr: [2046] EPGSearch: timer conflict check finished
  1560. Oct 27 20:18:22 localhost vdr: audio: 44100Hz supports 1 2 3 4 5 6 7 8 channels
  1561. Oct 27 20:18:22 localhost vdr: audio: 48000Hz supports 1 2 3 4 5 6 7 8 channels
  1562. Oct 27 20:18:22 localhost vdr: audio: 192000Hz supports 1 2 3 4 5 6 7 8 channels
  1563. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:change_state with command atta and options "-d :0" to attached
  1564. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:check_state(): got status code: 910
  1565. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:softhddevice successfully attached
  1566. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:current PrimaryDevice is softhddevice-openglosd (Index: 2, Number: 2, hasDecoder: True, isPrimary: True)
  1567. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:{self.name} is the primary device
  1568. Oct 27 20:18:22 localhost yavdr-frontend[2061]: DEBUG:softhddevice:needed 0.001 s to switch primary device
  1569. Oct 27 20:18:22 localhost vdr: audio/alsa: using device 'default'
  1570. Oct 27 20:18:22 localhost vdr: audio/alsa: start delay 336ms
  1571. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2268]: Upgrading MySQL tables if necessary.
  1572. Oct 27 20:18:23 localhost vdr: video/vdpau: synced after 31 frames
  1573. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: /usr/bin/mysql_upgrade: the '--basedir' option is always ignored
  1574. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: Looking for 'mysql' as: /usr/bin/mysql
  1575. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: Looking for 'mysqlcheck' as: /usr/bin/mysqlcheck
  1576. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2271]: This installation of MySQL is already upgraded to 10.1.41-MariaDB, use --force if you still need to run mysql_upgrade
  1577. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2279]: Checking for insecure root accounts.
  1578. Oct 27 20:18:23 localhost vdr: video: slow down video, duping frame
  1579. Oct 27 20:18:23 localhost vdr: video: 5:07:09.955 +105 386 0/\ms 10+7+4 v-buf
  1580. Oct 27 20:18:23 localhost /etc/mysql/debian-start[2283]: Triggering myisam-recover for all MyISAM tables and aria-recover for all Aria tables
  1581. Oct 27 20:18:23 localhost systemd[1]: Started MariaDB 10.1.41 database server.
  1582. Oct 27 20:18:23 localhost systemd[1]: Starting vdr-epg-daemon manages EPG data in a MySQL database...
  1583. Oct 27 20:18:23 localhost epgd: Set locale to 'de_AT.UTF-8'
  1584. Oct 27 20:18:23 localhost epgd: Calling sd_notify(READY=1$STATUS=Ready$MAINPID=2292$)
  1585. Oct 27 20:18:23 localhost systemd[1]: Started vdr-epg-daemon manages EPG data in a MySQL database.
  1586. Oct 27 20:18:23 localhost epgd: Info: Systemd watchdog not configured, epgd won't be sending keep-alive messages!
  1587. Oct 27 20:18:23 localhost systemd[1]: Starting epghttpd provides a webinterface for epg data...
  1588. Oct 27 20:18:23 localhost epgd: Loading uuid from '/etc/epgd/uuid' succeeded [728B3EF7-3164-4835-8CB2-E96D3938FFD2]
  1589. Oct 27 20:18:23 localhost epgd: Dictionary '/etc/epgd/epg.dat' loaded
  1590. Oct 27 20:18:23 localhost epgd: Initialize python script '/etc/epgd/recording.py'
  1591. Oct 27 20:18:23 localhost epghttpd: Set locale to 'de_AT.UTF-8'
  1592. Oct 27 20:18:23 localhost epghttpd: detected UTF-8
  1593. Oct 27 20:18:23 localhost epghttpd: Read 29 option from /etc/epgd/epgd.conf
  1594. Oct 27 20:18:23 localhost epghttpd: Log level is set to (1)
  1595. Oct 27 20:18:23 localhost epghttpd: Initialize python script '/etc/epgd/recording.py'
  1596. Oct 27 20:18:23 localhost epgd: Loading plugin: /usr/lib/epgd/plugins/libepgd-epgdata.so
  1597. Oct 27 20:18:23 localhost epgd: Loading plugin: /usr/lib/epgd/plugins/libepgd-tvm.so
  1598. Oct 27 20:18:23 localhost epgd: Loading plugin: /usr/lib/epgd/plugins/libepgd-tvsp.so
  1599. Oct 27 20:18:23 localhost epgd: Read 29 option from /etc/epgd/epgd.conf
  1600. Oct 27 20:18:23 localhost epgd: Using syslog facility 'user' (8), log level set to (1)
  1601. Oct 27 20:18:23 localhost epgd: Info: Calling mysql_library_init()
  1602. Oct 27 20:18:23 localhost epghttpd: Initialize python script '/etc/epgd/recording.py'
  1603. Oct 27 20:18:23 localhost epgd: Info: Stylesheet '/etc/epgd/epgdata-utf-8.xsl' loaded
  1604. Oct 27 20:18:23 localhost epgd: Info: Stylesheet '/etc/epgd/tvmovie-utf-8.xsl' loaded
  1605. Oct 27 20:18:23 localhost epgd: Info: Stylesheet '/etc/epgd/tvsp-utf-8.xsl' loaded
  1606. Oct 27 20:18:23 localhost epgd: Checking database connection ...
  1607. Oct 27 20:18:23 localhost epgd: Calling mysql_init(2292)
  1608. Oct 27 20:18:23 localhost epghttpd: Dictionary '/etc/epgd/epg.dat' loaded
  1609. Oct 27 20:18:23 localhost epghttpd: Info: Calling mysql_library_init()
  1610. Oct 27 20:18:23 localhost epghttpd: Connecting to database at 'localhost:3306'
  1611. Oct 27 20:18:23 localhost epghttpd: Calling mysql_init(2300)
  1612. Oct 27 20:18:23 localhost epghttpd: SQL client character now 'utf8'
  1613. Oct 27 20:18:23 localhost epgd: SQL client character now 'utf8'
  1614. Oct 27 20:18:23 localhost epgd: Checking table structure and indices ...
  1615. Oct 27 20:18:23 localhost epgd: Checking table 'analyse'
  1616. Oct 27 20:18:23 localhost epgd: Checking table 'channelmap'
  1617. Oct 27 20:18:23 localhost epgd: Checking table 'components'
  1618. Oct 27 20:18:23 localhost epgd: Checking table 'episodes'
  1619. Oct 27 20:18:23 localhost epghttpd: Calling mysql_init(2300)
  1620. Oct 27 20:18:23 localhost epgd: Checking table 'events'
  1621. Oct 27 20:18:23 localhost epghttpd: Starting http server ...
  1622. Oct 27 20:18:23 localhost epghttpd: Listener at port 9999 established, waiting for connections
  1623. Oct 27 20:18:23 localhost systemd[1]: Started epghttpd provides a webinterface for epg data.
  1624. Oct 27 20:18:23 localhost epghttpd: Calling sd_notify(READY=1$STATUS=Ready$MAINPID=2300$)
  1625. Oct 27 20:18:23 localhost systemd[1]: Reached target Multi-User System.
  1626. Oct 27 20:18:23 localhost systemd[1]: Reached target Graphical Interface.
  1627. Oct 27 20:18:23 localhost systemd[1]: Starting Update UTMP about System Runlevel Changes...
  1628. Oct 27 20:18:23 localhost systemd[1]: Started Stop ureadahead data collection 45s after completed startup.
  1629. Oct 27 20:18:23 localhost epghttpd: Info: Systemd watchdog not configured, epgd won't be sending keep-alive messages!
  1630. Oct 27 20:18:23 localhost systemd[1]: Started Update UTMP about System Runlevel Changes.
  1631. Oct 27 20:18:23 localhost systemd[1]: Startup finished in 4.262s (kernel) + 17.816s (userspace) = 22.078s.
  1632. Oct 27 20:18:23 localhost epgd: Checking table 'fileref'
  1633. Oct 27 20:18:23 localhost epgd: Checking table 'imagerefs'
  1634. Oct 27 20:18:23 localhost epgd: Checking table 'images'
  1635. Oct 27 20:18:23 localhost epgd: Checking table 'messages'
  1636. Oct 27 20:18:23 localhost epgd: Checking table 'movie'
  1637. Oct 27 20:18:23 localhost epgd: Checking table 'movie_actor'
  1638. Oct 27 20:18:23 localhost epgd: Checking table 'movie_actors'
  1639. Oct 27 20:18:23 localhost epgd: Checking table 'movie_media'
  1640. Oct 27 20:18:23 localhost epgd: Checking table 'parameters'
  1641. Oct 27 20:18:23 localhost epgd: Checking table 'recordingdirs'
  1642. Oct 27 20:18:23 localhost epgd: Checking table 'recordingimages'
  1643. Oct 27 20:18:23 localhost epgd: Checking table 'recordinglist'
  1644. Oct 27 20:18:23 localhost epgd: Checking table 'searchtimers'
  1645. Oct 27 20:18:23 localhost epgd: Checking table 'series'
  1646. Oct 27 20:18:23 localhost epgd: Checking table 'series_actor'
  1647. Oct 27 20:18:23 localhost epgd: Checking table 'series_episode'
  1648. Oct 27 20:18:23 localhost epgd: Checking table 'series_media'
  1649. Oct 27 20:18:23 localhost epgd: Checking table 'snapshot'
  1650. Oct 27 20:18:23 localhost epgd: Checking table 'timers'
  1651. Oct 27 20:18:23 localhost epgd: Checking table 'timersdone'
  1652. Oct 27 20:18:23 localhost epgd: Checking table 'useevents'
  1653. Oct 27 20:18:23 localhost epgd: Checking table 'users'
  1654. Oct 27 20:18:23 localhost epgd: Checking table 'vdrs'
  1655. Oct 27 20:18:23 localhost epgd: Closing mysql connection and calling mysql_thread_end(2292)
  1656. Oct 27 20:18:23 localhost epgd: Checking table structure and indices succeeded
  1657. Oct 27 20:18:23 localhost epgd: Calling mysql_init(2292)
  1658. Oct 27 20:18:23 localhost epgd: State now 'init'
  1659. Oct 27 20:18:23 localhost epgd: Loading '/etc/epgd/channelmap.conf'
  1660. Oct 27 20:18:23 localhost epgd: 343 channel mappings read.
  1661. Oct 27 20:18:23 localhost epgd: Calling mysql_init(2292)
  1662. Oct 27 20:18:23 localhost epgd: Using scraping language de
  1663. Oct 27 20:18:24 localhost epgd: TVDB scraper connected
  1664. Oct 27 20:18:25 localhost vdr: scraper2vdr: Got UUID 'EAF88110-7274-4A43-857C-FF31EC9605E1' by epg2vdr
  1665. Oct 27 20:18:25 localhost vdr: scraper2vdr: Trying to re-connect to database!
  1666. Oct 27 20:18:25 localhost vdr: scraper2vdr: Calling mysql_init(2057)
  1667. Oct 27 20:18:25 localhost vdr: scraper2vdr: SQL client character now 'utf8'
  1668. Oct 27 20:18:25 localhost vdr: scraper2vdr: Connection established successfull!
  1669. Oct 27 20:18:26 localhost vdr: [2223] animator thread thread ended (pid=1799, tid=2223)
  1670. Oct 27 20:18:26 localhost epgd: MOVIEDB scraper connected
  1671. Oct 27 20:18:26 localhost epgd: Scheduled next update in 10 second(s)
  1672. Oct 27 20:18:26 localhost epgd: State now 'standby'
  1673. Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 client connection accepted
  1674. Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR > 192.168.192.150:43208 server created
  1675. Oct 27 20:18:26 localhost epgd: Send 'PLUG epg2vdr STATE standby' to '192.168.192.150:6419'
  1676. Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 lost connection to client
  1677. Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 connection closed
  1678. Oct 27 20:18:26 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43208 server destroyed
  1679. Oct 27 20:18:27 localhost epgd: TCC: Starting timer conflict check
  1680. Oct 27 20:18:27 localhost epgd: TCC: Finished timer conflict check with (0) conflicts
  1681. Oct 27 20:18:27 localhost epgd: Checking timers against actual epg and searchtimer settings
  1682. Oct 27 20:18:27 localhost epgd: Timers check done
  1683. Oct 27 20:18:27 localhost epgd: AUTOTIMER: Updating searchtimers due to 'search timer changed'
  1684. Oct 27 20:18:27 localhost epgd: AUTOTIMER: Update done after 0 ms, created (0) timers
  1685. Oct 27 20:18:28 localhost vdr: scraper2vdr: Got 30409 new scraped Events from Database
  1686. Oct 27 20:18:28 localhost vdr: scraper2vdr: Loading Movies information from Database...
  1687. Oct 27 20:18:29 localhost vdr: scraper2vdr: Got 533 new/updated Movies in 1s from Database (new max scrsp: 1572165187)
  1688. Oct 27 20:18:29 localhost vdr: scraper2vdr: Loading Movies content from Database...
  1689. Oct 27 20:18:30 localhost vdr: [1799] [softhddev]CreateOsd: left 0, top 0, level 0, using OpenGL OSD support
  1690. Oct 27 20:18:30 localhost vdr: [1799] [softhddev]Trying to start OpenGL Worker Thread
  1691. Oct 27 20:18:30 localhost vdr: [2415] oglThread thread started (pid=1799, tid=2415, prio=high)
  1692. Oct 27 20:18:30 localhost vdr: [2415] [softhddev]OpenGL using display :0
  1693. Oct 27 20:18:31 localhost vdr: [2415] [softhddev]OpenGL Context initialized
  1694. Oct 27 20:18:31 localhost vdr: [2415] [softhddev]Shaders initialized
  1695. Oct 27 20:18:31 localhost vdr: [2415] [softhddev]vdpau interop initialized
  1696. Oct 27 20:18:31 localhost vdr: [2415] [softhddev]Vertex buffers initialized
  1697. Oct 27 20:18:31 localhost vdr: [2415] [softhddev]Maximum Pixmap size: 16384x16384px
  1698. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]OpenGL Worker Thread successfully started
  1699. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]cOglOsd osdLeft 0 osdTop 0 screenWidth 1920 screenHeight 1080
  1700. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1701. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1702. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1703. Oct 27 20:18:31 localhost vdr: [1799] switching to channel 35 S19.2E-1-1107-17505 (Pro7 MAXX)
  1704. Oct 27 20:18:31 localhost vdr: [2111] osdteletext-receiver thread ended (pid=1799, tid=2111)
  1705. Oct 27 20:18:31 localhost vdr: [1799] buffer stats: 0 (0%) used
  1706. Oct 27 20:18:31 localhost vdr: [2114] device 1 TS buffer thread ended (pid=1799, tid=2114)
  1707. Oct 27 20:18:31 localhost vdr: [2108] buffer stats: 83096 (1%) used
  1708. Oct 27 20:18:31 localhost vdr: [2108] device 1 receiver thread ended (pid=1799, tid=2108)
  1709. Oct 27 20:18:31 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1107-17505
  1710. Oct 27 20:18:31 localhost vdr: [2417] device 1 receiver thread started (pid=1799, tid=2417, prio=high)
  1711. Oct 27 20:18:31 localhost vdr: [2418] osdteletext-receiver thread started (pid=1799, tid=2418, prio=high)
  1712. Oct 27 20:18:31 localhost vdr: [2420] device 1 TS buffer thread started (pid=1799, tid=2420, prio=high)
  1713. Oct 27 20:18:31 localhost vdr: epg2vdr: Answer 'Epg2Vdr_Timer_Service-v1.0' call with 0 timers, duration was (1 ms)
  1714. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1715. Oct 27 20:18:31 localhost vdr: [2421] animator thread thread started (pid=1799, tid=2421, prio=high)
  1716. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1717. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1718. Oct 27 20:18:31 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1719. Oct 27 20:18:31 localhost vdr: [1799] switching to channel 35 S19.2E-1-1107-17505 (Pro7 MAXX)
  1720. Oct 27 20:18:31 localhost vdr: [2418] osdteletext-receiver thread ended (pid=1799, tid=2418)
  1721. Oct 27 20:18:31 localhost vdr: video: slow down video, duping frame
  1722. Oct 27 20:18:31 localhost vdr: video: decoder buffer empty, duping frame (5/420) 0 v-buf
  1723. Oct 27 20:18:31 localhost vdr: video: --:--:--.--- +0 0 0/\ms 0+5+4 v-buf
  1724. Oct 27 20:18:31 localhost vdr: [1799] buffer stats: 0 (0%) used
  1725. Oct 27 20:18:31 localhost vdr: [2420] device 1 TS buffer thread ended (pid=1799, tid=2420)
  1726. Oct 27 20:18:31 localhost vdr: [2417] buffer stats: 0 (0%) used
  1727. Oct 27 20:18:31 localhost vdr: [2417] device 1 receiver thread ended (pid=1799, tid=2417)
  1728. Oct 27 20:18:31 localhost vdr: [2424] osdteletext-receiver thread started (pid=1799, tid=2424, prio=high)
  1729. Oct 27 20:18:31 localhost vdr: [2423] device 1 receiver thread started (pid=1799, tid=2423, prio=high)
  1730. Oct 27 20:18:31 localhost vdr: [2425] device 1 TS buffer thread started (pid=1799, tid=2425, prio=high)
  1731. Oct 27 20:18:31 localhost vdr: scraper2vdr: Got 0 new/updated Image information in 2s from Database
  1732. Oct 27 20:18:31 localhost vdr: scraper2vdr: Loading Series information from Database...
  1733. Oct 27 20:18:31 localhost vdr: [1799] switching to channel 32 S19.2E-1-1003-13223 (ATV2)
  1734. Oct 27 20:18:31 localhost vdr: [2424] osdteletext-receiver thread ended (pid=1799, tid=2424)
  1735. Oct 27 20:18:31 localhost vdr: [1799] buffer stats: 0 (0%) used
  1736. Oct 27 20:18:31 localhost vdr: [2425] device 1 TS buffer thread ended (pid=1799, tid=2425)
  1737. Oct 27 20:18:31 localhost vdr: [2423] buffer stats: 50384 (0%) used
  1738. Oct 27 20:18:31 localhost vdr: [2423] device 1 receiver thread ended (pid=1799, tid=2423)
  1739. Oct 27 20:18:31 localhost vdr: [1799] CAM 1: assigned to device 1
  1740. Oct 27 20:18:31 localhost vdr: [2427] device 1 receiver thread started (pid=1799, tid=2427, prio=high)
  1741. Oct 27 20:18:31 localhost vdr: [2428] device 1 TS buffer thread started (pid=1799, tid=2428, prio=high)
  1742. Oct 27 20:18:32 localhost vdr: [1799] DVBAPI: 0.0 set CAM decrypt (SID 13223 (0x33A7), caLm 5, HasCaDescriptors 0)
  1743. Oct 27 20:18:32 localhost vdr: [1799] DVBAPI: 0.0 set CAM decrypt (SID 13223 (0x33A7), caLm 4, HasCaDescriptors 0)
  1744. Oct 27 20:18:32 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1003-13223
  1745. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1746. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1747. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1748. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1749. Oct 27 20:18:32 localhost vdr: [1799] DVBAPI: 0.0 set CAM decrypt (SID 13223 (0x33A7), caLm 5, HasCaDescriptors 0)
  1750. Oct 27 20:18:32 localhost vdr: [1799] CAM 1: unassigned from device 1
  1751. Oct 27 20:18:32 localhost vdr: [1799] switching to channel 31 S19.2E-1-1039-10378 (SR Fernsehen HD)
  1752. Oct 27 20:18:32 localhost vdr: [2429] osdteletext-receiver thread started (pid=1799, tid=2429, prio=high)
  1753. Oct 27 20:18:32 localhost vdr: [2429] osdteletext-receiver thread ended (pid=1799, tid=2429)
  1754. Oct 27 20:18:32 localhost vdr: [1799] buffer stats: 0 (0%) used
  1755. Oct 27 20:18:32 localhost vdr: [2428] device 1 TS buffer thread ended (pid=1799, tid=2428)
  1756. Oct 27 20:18:32 localhost vdr: [2427] buffer stats: 0 (0%) used
  1757. Oct 27 20:18:32 localhost vdr: [2427] device 1 receiver thread ended (pid=1799, tid=2427)
  1758. Oct 27 20:18:32 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1039-10378
  1759. Oct 27 20:18:32 localhost vdr: [2433] osdteletext-receiver thread started (pid=1799, tid=2433, prio=high)
  1760. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1761. Oct 27 20:18:32 localhost vdr: [2432] device 1 receiver thread started (pid=1799, tid=2432, prio=high)
  1762. Oct 27 20:18:32 localhost vdr: [2434] device 1 TS buffer thread started (pid=1799, tid=2434, prio=high)
  1763. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1764. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1765. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1766. Oct 27 20:18:32 localhost vdr: [1799] switching to channel 30 S19.2E-1-1025-10329 (NDR FS HH HD)
  1767. Oct 27 20:18:32 localhost vdr: [2433] osdteletext-receiver thread ended (pid=1799, tid=2433)
  1768. Oct 27 20:18:32 localhost vdr: [1799] buffer stats: 0 (0%) used
  1769. Oct 27 20:18:32 localhost vdr: [2434] device 1 TS buffer thread ended (pid=1799, tid=2434)
  1770. Oct 27 20:18:32 localhost vdr: [2432] buffer stats: 0 (0%) used
  1771. Oct 27 20:18:32 localhost vdr: [2432] device 1 receiver thread ended (pid=1799, tid=2432)
  1772. Oct 27 20:18:32 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1025-10329
  1773. Oct 27 20:18:32 localhost vdr: [2436] osdteletext-receiver thread started (pid=1799, tid=2436, prio=high)
  1774. Oct 27 20:18:32 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1775. Oct 27 20:18:32 localhost vdr: [2435] device 1 receiver thread started (pid=1799, tid=2435, prio=high)
  1776. Oct 27 20:18:32 localhost vdr: [2437] device 1 TS buffer thread started (pid=1799, tid=2437, prio=high)
  1777. Oct 27 20:18:33 localhost vdr: audio/alsa: using device 'default'
  1778. Oct 27 20:18:33 localhost vdr: audio/alsa: start delay 600ms
  1779. Oct 27 20:18:33 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1780. Oct 27 20:18:33 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1781. Oct 27 20:18:33 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1782. Oct 27 20:18:33 localhost vdr: [1799] switching to channel 29 S19.2E-1-1061-10351 (rbb Berlin HD)
  1783. Oct 27 20:18:33 localhost vdr: scraper2vdr: Got 783 new/updated Series in 2s from Database (new max scrsp: 1572165173)
  1784. Oct 27 20:18:33 localhost vdr: scraper2vdr: Loading Series content from Database...
  1785. Oct 27 20:18:33 localhost vdr: [2436] osdteletext-receiver thread ended (pid=1799, tid=2436)
  1786. Oct 27 20:18:33 localhost vdr: [1799] buffer stats: 0 (0%) used
  1787. Oct 27 20:18:33 localhost vdr: [2437] device 1 TS buffer thread ended (pid=1799, tid=2437)
  1788. Oct 27 20:18:33 localhost vdr: [2435] buffer stats: 149272 (2%) used
  1789. Oct 27 20:18:33 localhost vdr: [2435] device 1 receiver thread ended (pid=1799, tid=2435)
  1790. Oct 27 20:18:33 localhost vdr: [2633] device 1 receiver thread started (pid=1799, tid=2633, prio=high)
  1791. Oct 27 20:18:33 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1061-10351
  1792. Oct 27 20:18:33 localhost vdr: [2634] osdteletext-receiver thread started (pid=1799, tid=2634, prio=high)
  1793. Oct 27 20:18:33 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1794. Oct 27 20:18:33 localhost vdr: [2635] device 1 TS buffer thread started (pid=1799, tid=2635, prio=high)
  1795. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1796. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1797. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1798. Oct 27 20:18:34 localhost vdr: [1799] switching to channel 28 S19.2E-1-1019-10303 (SWR BW HD)
  1799. Oct 27 20:18:34 localhost vdr: [2634] osdteletext-receiver thread ended (pid=1799, tid=2634)
  1800. Oct 27 20:18:34 localhost vdr: [1799] buffer stats: 0 (0%) used
  1801. Oct 27 20:18:34 localhost vdr: [2635] device 1 TS buffer thread ended (pid=1799, tid=2635)
  1802. Oct 27 20:18:34 localhost vdr: [2633] buffer stats: 81404 (1%) used
  1803. Oct 27 20:18:34 localhost vdr: [2633] device 1 receiver thread ended (pid=1799, tid=2633)
  1804. Oct 27 20:18:34 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1019-10303
  1805. Oct 27 20:18:34 localhost vdr: [2639] osdteletext-receiver thread started (pid=1799, tid=2639, prio=high)
  1806. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1807. Oct 27 20:18:34 localhost vdr: [2638] device 1 receiver thread started (pid=1799, tid=2638, prio=high)
  1808. Oct 27 20:18:34 localhost vdr: [2640] device 1 TS buffer thread started (pid=1799, tid=2640, prio=high)
  1809. Oct 27 20:18:34 localhost vdr: [softhddev] invalid PES video packet
  1810. Oct 27 20:18:34 localhost vdr: audio/alsa: using device 'default'
  1811. Oct 27 20:18:34 localhost vdr: audio/alsa: start delay 600ms
  1812. Oct 27 20:18:34 localhost vdr: [softhddev] 3 invalid PES video packet(s)
  1813. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1814. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1815. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1816. Oct 27 20:18:34 localhost vdr: [1799] switching to channel 27 S19.2E-1-1101-28111 (WDR Köln)
  1817. Oct 27 20:18:34 localhost vdr: [2639] osdteletext-receiver thread ended (pid=1799, tid=2639)
  1818. Oct 27 20:18:34 localhost vdr: [1799] buffer stats: 0 (0%) used
  1819. Oct 27 20:18:34 localhost vdr: [2640] device 1 TS buffer thread ended (pid=1799, tid=2640)
  1820. Oct 27 20:18:34 localhost vdr: [2638] buffer stats: 171080 (3%) used
  1821. Oct 27 20:18:34 localhost vdr: [2638] device 1 receiver thread ended (pid=1799, tid=2638)
  1822. Oct 27 20:18:34 localhost vdr: [2643] device 1 receiver thread started (pid=1799, tid=2643, prio=high)
  1823. Oct 27 20:18:34 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1101-28111
  1824. Oct 27 20:18:34 localhost vdr: [2645] osdteletext-receiver thread started (pid=1799, tid=2645, prio=high)
  1825. Oct 27 20:18:34 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1826. Oct 27 20:18:34 localhost vdr: [2644] device 1 TS buffer thread started (pid=1799, tid=2644, prio=high)
  1827. Oct 27 20:18:35 localhost vdr: audio/alsa: using device 'default'
  1828. Oct 27 20:18:35 localhost vdr: audio/alsa: start delay 600ms
  1829. Oct 27 20:18:35 localhost vdr: [softhddev] invalid PES video packet
  1830. Oct 27 20:18:35 localhost vdr: [softhddev] 2 invalid PES video packet(s)
  1831. Oct 27 20:18:35 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1832. Oct 27 20:18:35 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1833. Oct 27 20:18:35 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1834. Oct 27 20:18:35 localhost vdr: [1799] switching to channel 26 S19.2E-1-1061-10355 (hr-fernsehen HD)
  1835. Oct 27 20:18:35 localhost vdr: [2645] osdteletext-receiver thread ended (pid=1799, tid=2645)
  1836. Oct 27 20:18:35 localhost vdr: [1799] buffer stats: 0 (0%) used
  1837. Oct 27 20:18:35 localhost vdr: [2644] device 1 TS buffer thread ended (pid=1799, tid=2644)
  1838. Oct 27 20:18:35 localhost vdr: [2643] buffer stats: 70124 (1%) used
  1839. Oct 27 20:18:35 localhost vdr: [2643] device 1 receiver thread ended (pid=1799, tid=2643)
  1840. Oct 27 20:18:35 localhost vdr: [2648] device 1 receiver thread started (pid=1799, tid=2648, prio=high)
  1841. Oct 27 20:18:35 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1061-10355
  1842. Oct 27 20:18:35 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1843. Oct 27 20:18:35 localhost vdr: [2649] device 1 TS buffer thread started (pid=1799, tid=2649, prio=high)
  1844. Oct 27 20:18:35 localhost vdr: [2650] osdteletext-receiver thread started (pid=1799, tid=2650, prio=high)
  1845. Oct 27 20:18:36 localhost vdr: audio/alsa: using device 'default'
  1846. Oct 27 20:18:36 localhost vdr: audio/alsa: start delay 600ms
  1847. Oct 27 20:18:36 localhost epgd: State now 'busy (events)'
  1848. Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 client connection accepted
  1849. Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR > 192.168.192.150:43210 server created
  1850. Oct 27 20:18:36 localhost epgd: Send 'PLUG epg2vdr STATE busy (events)' to '192.168.192.150:6419'
  1851. Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 lost connection to client
  1852. Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 connection closed
  1853. Oct 27 20:18:36 localhost vdr: [2112] SVDRP myVDR < 192.168.192.150:43210 server destroyed
  1854. Oct 27 20:18:36 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1855. Oct 27 20:18:36 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1856. Oct 27 20:18:36 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1857. Oct 27 20:18:36 localhost vdr: [1799] switching to channel 25 S19.2E-1-1061-10353 (MDR S-Anhalt HD)
  1858. Oct 27 20:18:36 localhost vdr: [2650] osdteletext-receiver thread ended (pid=1799, tid=2650)
  1859. Oct 27 20:18:36 localhost vdr: [1799] buffer stats: 0 (0%) used
  1860. Oct 27 20:18:37 localhost vdr: [2649] device 1 TS buffer thread ended (pid=1799, tid=2649)
  1861. Oct 27 20:18:37 localhost vdr: [2648] buffer stats: 214132 (4%) used
  1862. Oct 27 20:18:37 localhost vdr: [2648] device 1 receiver thread ended (pid=1799, tid=2648)
  1863. Oct 27 20:18:37 localhost vdr: [2655] device 1 receiver thread started (pid=1799, tid=2655, prio=high)
  1864. Oct 27 20:18:37 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1061-10353
  1865. Oct 27 20:18:37 localhost vdr: [2657] osdteletext-receiver thread started (pid=1799, tid=2657, prio=high)
  1866. Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1867. Oct 27 20:18:37 localhost vdr: [2656] device 1 TS buffer thread started (pid=1799, tid=2656, prio=high)
  1868. Oct 27 20:18:37 localhost vdr: audio/alsa: using device 'default'
  1869. Oct 27 20:18:37 localhost vdr: audio/alsa: start delay 600ms
  1870. Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1871. Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1872. Oct 27 20:18:37 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1873. Oct 27 20:18:37 localhost vdr: [1799] switching to channel 24 S19.2E-133-5-772 (TLC)
  1874. Oct 27 20:18:37 localhost vdr: [2657] osdteletext-receiver thread ended (pid=1799, tid=2657)
  1875. Oct 27 20:18:37 localhost vdr: [1799] buffer stats: 0 (0%) used
  1876. Oct 27 20:18:37 localhost vdr: [2656] device 1 TS buffer thread ended (pid=1799, tid=2656)
  1877. Oct 27 20:18:37 localhost vdr: [2655] buffer stats: 131412 (2%) used
  1878. Oct 27 20:18:37 localhost vdr: [2655] device 1 receiver thread ended (pid=1799, tid=2655)
  1879. Oct 27 20:18:37 localhost vdr: [2660] device 1 receiver thread started (pid=1799, tid=2660, prio=high)
  1880. Oct 27 20:18:37 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-133-5-772
  1881. Oct 27 20:18:37 localhost vdr: [2661] device 1 TS buffer thread started (pid=1799, tid=2661, prio=high)
  1882. Oct 27 20:18:37 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1883. Oct 27 20:18:37 localhost vdr: [2662] osdteletext-receiver thread started (pid=1799, tid=2662, prio=high)
  1884. Oct 27 20:18:38 localhost vdr: scraper2vdr: Got 3630 new/updated Episodes and 2267 new/updated Image information (including 1794 possible not available season poster) in 5s from Database
  1885. Oct 27 20:18:38 localhost vdr: scraper2vdr: Loading Image content from Database...
  1886. Oct 27 20:18:38 localhost vdr: audio/alsa: using device 'default'
  1887. Oct 27 20:18:38 localhost vdr: audio/alsa: start delay 600ms
  1888. Oct 27 20:18:38 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1889. Oct 27 20:18:38 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1890. Oct 27 20:18:38 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1891. Oct 27 20:18:38 localhost vdr: [1799] switching to channel 23 S19.2E-1-1115-13106 (sixx Austria)
  1892. Oct 27 20:18:38 localhost vdr: [2662] osdteletext-receiver thread ended (pid=1799, tid=2662)
  1893. Oct 27 20:18:38 localhost vdr: [1799] buffer stats: 0 (0%) used
  1894. Oct 27 20:18:38 localhost vdr: [2661] device 1 TS buffer thread ended (pid=1799, tid=2661)
  1895. Oct 27 20:18:38 localhost vdr: [2660] buffer stats: 51324 (0%) used
  1896. Oct 27 20:18:38 localhost vdr: [2660] device 1 receiver thread ended (pid=1799, tid=2660)
  1897. Oct 27 20:18:38 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1115-13106
  1898. Oct 27 20:18:38 localhost vdr: [2667] osdteletext-receiver thread started (pid=1799, tid=2667, prio=high)
  1899. Oct 27 20:18:38 localhost vdr: [2666] device 1 receiver thread started (pid=1799, tid=2666, prio=high)
  1900. Oct 27 20:18:38 localhost vdr: [2668] device 1 TS buffer thread started (pid=1799, tid=2668, prio=high)
  1901. Oct 27 20:18:38 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1902. Oct 27 20:18:38 localhost epgd: Starting cleanup of events
  1903. Oct 27 20:18:38 localhost epgd: Delete fileref [substr(name,1,8) <= '20191026' and source = 'epgdata']
  1904. Oct 27 20:18:38 localhost epgd: Delete events [starttime+duration < 1572182318]
  1905. Oct 27 20:18:39 localhost vdr: audio/alsa: using device 'default'
  1906. Oct 27 20:18:39 localhost vdr: audio/alsa: start delay 600ms
  1907. Oct 27 20:18:39 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1908. Oct 27 20:18:39 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1909. Oct 27 20:18:39 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1910. Oct 27 20:18:39 localhost vdr: [1799] switching to channel 22 S19.2E-133-33-51 (TELE 5)
  1911. Oct 27 20:18:39 localhost vdr: [2667] osdteletext-receiver thread ended (pid=1799, tid=2667)
  1912. Oct 27 20:18:39 localhost vdr: [1799] buffer stats: 0 (0%) used
  1913. Oct 27 20:18:39 localhost vdr: [2668] device 1 TS buffer thread ended (pid=1799, tid=2668)
  1914. Oct 27 20:18:39 localhost vdr: [2666] buffer stats: 42112 (0%) used
  1915. Oct 27 20:18:39 localhost vdr: [2666] device 1 receiver thread ended (pid=1799, tid=2666)
  1916. Oct 27 20:18:39 localhost vdr: [2682] device 1 receiver thread started (pid=1799, tid=2682, prio=high)
  1917. Oct 27 20:18:39 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-133-33-51
  1918. Oct 27 20:18:39 localhost vdr: [2683] device 1 TS buffer thread started (pid=1799, tid=2683, prio=high)
  1919. Oct 27 20:18:39 localhost vdr: [2684] osdteletext-receiver thread started (pid=1799, tid=2684, prio=high)
  1920. Oct 27 20:18:39 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1921. Oct 27 20:18:40 localhost vdr: audio/alsa: using device 'default'
  1922. Oct 27 20:18:40 localhost vdr: audio/alsa: start delay 600ms
  1923. Oct 27 20:18:40 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1924. Oct 27 20:18:40 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1925. Oct 27 20:18:40 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1926. Oct 27 20:18:40 localhost vdr: [1799] switching to channel 21 S19.2E-133-5-764 (ANIXE+)
  1927. Oct 27 20:18:40 localhost vdr: [2684] osdteletext-receiver thread ended (pid=1799, tid=2684)
  1928. Oct 27 20:18:40 localhost vdr: [1799] buffer stats: 0 (0%) used
  1929. Oct 27 20:18:40 localhost vdr: [2683] device 1 TS buffer thread ended (pid=1799, tid=2683)
  1930. Oct 27 20:18:40 localhost vdr: [2682] buffer stats: 30456 (0%) used
  1931. Oct 27 20:18:40 localhost vdr: [2682] device 1 receiver thread ended (pid=1799, tid=2682)
  1932. Oct 27 20:18:40 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1933. Oct 27 20:18:40 localhost vdr: [2688] device 1 receiver thread started (pid=1799, tid=2688, prio=high)
  1934. Oct 27 20:18:40 localhost vdr: [2689] device 1 TS buffer thread started (pid=1799, tid=2689, prio=high)
  1935. Oct 27 20:18:40 localhost vdr: audio/alsa: using device 'default'
  1936. Oct 27 20:18:40 localhost vdr: audio/alsa: start delay 600ms
  1937. Oct 27 20:18:40 localhost epgd: Delete useevents [cnt_starttime+cnt_duration < 1572182318]
  1938. Oct 27 20:18:40 localhost epgd: SQL-Error in 'delete from useevents where cnt_starttime+cnt_duration < 1572182318' - Index useevents is corrupted (1712)
  1939. Oct 27 20:18:40 localhost epgd: SQL-Error in 'deleteWhere()' - Index useevents is corrupted (1712) '' [delete from useevents where cnt_starttime+cnt_duration < 1572182318]
  1940. Oct 27 20:18:41 localhost epgd: Cleanup of events finished
  1941. Oct 27 20:18:41 localhost epgd: Starting cleanup of failed timer actions, older than 10 days
  1942. Oct 27 20:18:41 localhost epgd: Cleanup of timer actions finished
  1943. Oct 27 20:18:41 localhost epgd: Calling sd_notify(STATUS=Busy, started Update)
  1944. Oct 27 20:18:41 localhost epgd: EPG Update started
  1945. Oct 27 20:18:41 localhost epgd: Updating 'tvm' day today+0 now
  1946. Oct 27 20:18:41 localhost epgd: Checking tvm id 1
  1947. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1948. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1949. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1950. Oct 27 20:18:41 localhost vdr: [1799] switching to channel 20 S19.2E-1-1019-10302 (arte HD)
  1951. Oct 27 20:18:41 localhost vdr: [2689] device 1 TS buffer thread ended (pid=1799, tid=2689)
  1952. Oct 27 20:18:41 localhost vdr: [2688] buffer stats: 43240 (0%) used
  1953. Oct 27 20:18:41 localhost vdr: [2688] device 1 receiver thread ended (pid=1799, tid=2688)
  1954. Oct 27 20:18:41 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1019-10302
  1955. Oct 27 20:18:41 localhost vdr: [2694] device 1 receiver thread started (pid=1799, tid=2694, prio=high)
  1956. Oct 27 20:18:41 localhost vdr: [2696] device 1 TS buffer thread started (pid=1799, tid=2696, prio=high)
  1957. Oct 27 20:18:41 localhost vdr: [2695] osdteletext-receiver thread started (pid=1799, tid=2695, prio=high)
  1958. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1959. Oct 27 20:18:41 localhost vdr: audio/alsa: using device 'default'
  1960. Oct 27 20:18:41 localhost vdr: audio/alsa: start delay 600ms
  1961. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1962. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1963. Oct 27 20:18:41 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1964. Oct 27 20:18:41 localhost vdr: [1799] switching to channel 20 S19.2E-1-1019-10302 (arte HD)
  1965. Oct 27 20:18:41 localhost vdr: [2695] osdteletext-receiver thread ended (pid=1799, tid=2695)
  1966. Oct 27 20:18:41 localhost vdr: [1799] buffer stats: 0 (0%) used
  1967. Oct 27 20:18:41 localhost vdr: [2696] device 1 TS buffer thread ended (pid=1799, tid=2696)
  1968. Oct 27 20:18:41 localhost vdr: [2694] buffer stats: 153972 (2%) used
  1969. Oct 27 20:18:41 localhost vdr: [2694] device 1 receiver thread ended (pid=1799, tid=2694)
  1970. Oct 27 20:18:41 localhost vdr: [2699] osdteletext-receiver thread started (pid=1799, tid=2699, prio=high)
  1971. Oct 27 20:18:41 localhost vdr: [2698] device 1 receiver thread started (pid=1799, tid=2698, prio=high)
  1972. Oct 27 20:18:41 localhost vdr: [2700] device 1 TS buffer thread started (pid=1799, tid=2700, prio=high)
  1973. Oct 27 20:18:41 localhost vdr: [1799] switching to channel 19 S19.2E-133-33-63 (DMAX)
  1974. Oct 27 20:18:41 localhost vdr: [2699] osdteletext-receiver thread ended (pid=1799, tid=2699)
  1975. Oct 27 20:18:41 localhost vdr: [1799] buffer stats: 0 (0%) used
  1976. Oct 27 20:18:42 localhost vdr: [2700] device 1 TS buffer thread ended (pid=1799, tid=2700)
  1977. Oct 27 20:18:42 localhost vdr: [2698] buffer stats: 160552 (3%) used
  1978. Oct 27 20:18:42 localhost vdr: [2698] device 1 receiver thread ended (pid=1799, tid=2698)
  1979. Oct 27 20:18:42 localhost vdr: [2702] device 1 receiver thread started (pid=1799, tid=2702, prio=high)
  1980. Oct 27 20:18:42 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-133-33-63
  1981. Oct 27 20:18:42 localhost vdr: [2704] osdteletext-receiver thread started (pid=1799, tid=2704, prio=high)
  1982. Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1983. Oct 27 20:18:42 localhost vdr: [2703] device 1 TS buffer thread started (pid=1799, tid=2703, prio=high)
  1984. Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  1985. Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  1986. Oct 27 20:18:42 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  1987. Oct 27 20:18:42 localhost vdr: [1799] switching to channel 18 S19.2E-1-1089-12040 (SUPER RTL)
  1988. Oct 27 20:18:42 localhost vdr: [2704] osdteletext-receiver thread ended (pid=1799, tid=2704)
  1989. Oct 27 20:18:42 localhost vdr: [1799] buffer stats: 0 (0%) used
  1990. Oct 27 20:18:42 localhost vdr: [2703] device 1 TS buffer thread ended (pid=1799, tid=2703)
  1991. Oct 27 20:18:42 localhost vdr: [2702] buffer stats: 0 (0%) used
  1992. Oct 27 20:18:42 localhost vdr: [2702] device 1 receiver thread ended (pid=1799, tid=2702)
  1993. Oct 27 20:18:42 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1089-12040
  1994. Oct 27 20:18:42 localhost vdr: [2707] osdteletext-receiver thread started (pid=1799, tid=2707, prio=high)
  1995. Oct 27 20:18:42 localhost vdr: [2706] device 1 receiver thread started (pid=1799, tid=2706, prio=high)
  1996. Oct 27 20:18:42 localhost vdr: [2708] device 1 TS buffer thread started (pid=1799, tid=2708, prio=high)
  1997. Oct 27 20:18:42 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  1998. Oct 27 20:18:42 localhost vdr: scraper2vdr: Got 528 new/updated Images (found 1739 not available images) in 4s from Database
  1999. Oct 27 20:18:42 localhost epgd: Checking tvm id 11
  2000. Oct 27 20:18:42 localhost systemd-timesyncd[762]: Synchronized to time server 91.189.89.199:123 (ntp.ubuntu.com).
  2001. Oct 27 20:18:42 localhost epgd: Checking tvm id 111
  2002. Oct 27 20:18:42 localhost epgd: Checking tvm id 12
  2003. Oct 27 20:18:42 localhost vdr: audio/alsa: using device 'default'
  2004. Oct 27 20:18:42 localhost vdr: audio/alsa: start delay 600ms
  2005. Oct 27 20:18:43 localhost vdr: [softhddev] invalid PES video packet
  2006. Oct 27 20:18:43 localhost vdr: [softhddev] 2 invalid PES video packet(s)
  2007. Oct 27 20:18:43 localhost epgd: Checking tvm id 129
  2008. Oct 27 20:18:43 localhost epgd: Checking tvm id 13
  2009. Oct 27 20:18:43 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2010. Oct 27 20:18:43 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2011. Oct 27 20:18:43 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2012. Oct 27 20:18:43 localhost vdr: [1799] switching to channel 17 S19.2E-1-1091-28805 (VOX Austria)
  2013. Oct 27 20:18:43 localhost vdr: [2707] osdteletext-receiver thread ended (pid=1799, tid=2707)
  2014. Oct 27 20:18:43 localhost vdr: [1799] buffer stats: 0 (0%) used
  2015. Oct 27 20:18:43 localhost vdr: [2708] device 1 TS buffer thread ended (pid=1799, tid=2708)
  2016. Oct 27 20:18:43 localhost vdr: [2706] buffer stats: 55272 (1%) used
  2017. Oct 27 20:18:43 localhost vdr: [2706] device 1 receiver thread ended (pid=1799, tid=2706)
  2018. Oct 27 20:18:43 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1091-28805
  2019. Oct 27 20:18:43 localhost vdr: [2713] osdteletext-receiver thread started (pid=1799, tid=2713, prio=high)
  2020. Oct 27 20:18:43 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2021. Oct 27 20:18:43 localhost vdr: [2712] device 1 receiver thread started (pid=1799, tid=2712, prio=high)
  2022. Oct 27 20:18:43 localhost vdr: [2714] device 1 TS buffer thread started (pid=1799, tid=2714, prio=high)
  2023. Oct 27 20:18:43 localhost epgd: Checking tvm id 137
  2024. Oct 27 20:18:44 localhost epgd: Checking tvm id 14
  2025. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Die_glorreichen_Sieben/2019-09-16.01.48.1-0.rec/marks
  2026. Oct 27 20:18:44 localhost vdr: audio/alsa: using device 'default'
  2027. Oct 27 20:18:44 localhost vdr: audio/alsa: start delay 600ms
  2028. Oct 27 20:18:44 localhost epgd: Checking tvm id 16
  2029. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Pirates_of_the_Caribbean_4_–_Fremde_Gezeiten/2019-09-15.22.24.1-0.rec/marks
  2030. Oct 27 20:18:44 localhost epgd: Checking tvm id 168
  2031. Oct 27 20:18:44 localhost epgd: Checking tvm id 17
  2032. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Baumschlager/2019-06-01.01.01.1-0.rec/marks
  2033. Oct 27 20:18:44 localhost epgd: Checking tvm id 2
  2034. Oct 27 20:18:44 localhost epgd: Checking tvm id 269
  2035. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Lone_Ranger/2019-03-24.02.44.1-0.rec/marks
  2036. Oct 27 20:18:44 localhost epgd: Checking tvm id 294
  2037. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/scobel/scobel/2019-01-17.20.58.6-0.rec/marks
  2038. Oct 27 20:18:44 localhost epgd: Checking tvm id 3
  2039. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Gesund_durch_Fasten/Gesund_durch_Fasten/2019-01-17.20.13.6-0.rec/marks
  2040. Oct 27 20:18:44 localhost epgd: Checking tvm id 30
  2041. Oct 27 20:18:44 localhost epgd: Checking tvm id 301
  2042. Oct 27 20:18:44 localhost vdr: [2048] loading /srv/vdr/video/Zoomania/2018-12-26.18.08.1-0.rec/marks
  2043. Oct 27 20:18:44 localhost epgd: Checking tvm id 31
  2044. Oct 27 20:18:45 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2045. Oct 27 20:18:45 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2046. Oct 27 20:18:45 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2047. Oct 27 20:18:45 localhost vdr: [1799] switching to channel 16 S19.2E-1-1091-28810 (RTL2 Austria)
  2048. Oct 27 20:18:45 localhost vdr: [2713] osdteletext-receiver thread ended (pid=1799, tid=2713)
  2049. Oct 27 20:18:45 localhost vdr: [1799] buffer stats: 0 (0%) used
  2050. Oct 27 20:18:45 localhost epgd: Checking tvm id 314
  2051. Oct 27 20:18:45 localhost vdr: [2714] device 1 TS buffer thread ended (pid=1799, tid=2714)
  2052. Oct 27 20:18:45 localhost vdr: [2712] buffer stats: 47940 (0%) used
  2053. Oct 27 20:18:45 localhost vdr: [2712] device 1 receiver thread ended (pid=1799, tid=2712)
  2054. Oct 27 20:18:45 localhost vdr: [2720] device 1 receiver thread started (pid=1799, tid=2720, prio=high)
  2055. Oct 27 20:18:45 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1091-28810
  2056. Oct 27 20:18:45 localhost vdr: [2722] device 1 TS buffer thread started (pid=1799, tid=2722, prio=high)
  2057. Oct 27 20:18:45 localhost vdr: [2721] osdteletext-receiver thread started (pid=1799, tid=2721, prio=high)
  2058. Oct 27 20:18:45 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2059. Oct 27 20:18:45 localhost epgd: Checking tvm id 316
  2060. Oct 27 20:18:45 localhost vdr: audio/alsa: using device 'default'
  2061. Oct 27 20:18:45 localhost vdr: audio/alsa: start delay 600ms
  2062. Oct 27 20:18:45 localhost epgd: Checking tvm id 318
  2063. Oct 27 20:18:45 localhost epgd: Checking tvm id 38
  2064. Oct 27 20:18:45 localhost epgd: Checking tvm id 39
  2065. Oct 27 20:18:45 localhost epgd: Checking tvm id 4
  2066. Oct 27 20:18:45 localhost epgd: Checking tvm id 41
  2067. Oct 27 20:18:45 localhost epgd: Checking tvm id 427
  2068. Oct 27 20:18:45 localhost epgd: Checking tvm id 43
  2069. Oct 27 20:18:45 localhost epgd: Checking tvm id 430
  2070. Oct 27 20:18:45 localhost epgd: Checking tvm id 436
  2071. Oct 27 20:18:45 localhost epgd: Checking tvm id 437
  2072. Oct 27 20:18:45 localhost epgd: Checking tvm id 445
  2073. Oct 27 20:18:46 localhost epgd: Checking tvm id 447
  2074. Oct 27 20:18:46 localhost epgd: Checking tvm id 451
  2075. Oct 27 20:18:46 localhost vdr: video: decoder buffer empty, duping frame (639/8) 2 v-buf
  2076. Oct 27 20:18:46 localhost vdr: video: slow down video, duping frame
  2077. Oct 27 20:18:46 localhost vdr: video: 13:54:02.842 +106 520 0/\ms 17+7+4 v-buf
  2078. Oct 27 20:18:46 localhost vdr: video/vdpau: synced after 56 frames
  2079. Oct 27 20:18:46 localhost epgd: Checking tvm id 459
  2080. Oct 27 20:18:47 localhost epgd: Checking tvm id 46
  2081. Oct 27 20:18:47 localhost epgd: Checking tvm id 47
  2082. Oct 27 20:18:47 localhost epgd: Checking tvm id 48
  2083. Oct 27 20:18:47 localhost epgd: Checking tvm id 5
  2084. Oct 27 20:18:47 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2085. Oct 27 20:18:47 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2086. Oct 27 20:18:47 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2087. Oct 27 20:18:47 localhost vdr: [1799] switching to channel 15 S19.2E-1-1082-20004 (Kabel 1 Austria)
  2088. Oct 27 20:18:47 localhost vdr: [2721] osdteletext-receiver thread ended (pid=1799, tid=2721)
  2089. Oct 27 20:18:47 localhost vdr: [1799] buffer stats: 0 (0%) used
  2090. Oct 27 20:18:47 localhost epgd: Checking tvm id 52
  2091. Oct 27 20:18:47 localhost vdr: [2722] device 1 TS buffer thread ended (pid=1799, tid=2722)
  2092. Oct 27 20:18:47 localhost vdr: [2720] buffer stats: 30832 (0%) used
  2093. Oct 27 20:18:47 localhost vdr: [2720] device 1 receiver thread ended (pid=1799, tid=2720)
  2094. Oct 27 20:18:47 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1082-20004
  2095. Oct 27 20:18:47 localhost vdr: [2730] osdteletext-receiver thread started (pid=1799, tid=2730, prio=high)
  2096. Oct 27 20:18:47 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2097. Oct 27 20:18:47 localhost vdr: [2729] device 1 receiver thread started (pid=1799, tid=2729, prio=high)
  2098. Oct 27 20:18:47 localhost vdr: [2731] device 1 TS buffer thread started (pid=1799, tid=2731, prio=high)
  2099. Oct 27 20:18:47 localhost epgd: Checking tvm id 55
  2100. Oct 27 20:18:48 localhost epgd: Checking tvm id 57
  2101. Oct 27 20:18:48 localhost epgd: Checking tvm id 6
  2102. Oct 27 20:18:48 localhost vdr: [softhddev] invalid PES video packet
  2103. Oct 27 20:18:48 localhost vdr: [softhddev] 2 invalid PES video packet(s)
  2104. Oct 27 20:18:48 localhost vdr: audio/alsa: using device 'default'
  2105. Oct 27 20:18:48 localhost vdr: audio/alsa: start delay 600ms
  2106. Oct 27 20:18:48 localhost vdr: video: slow down video, duping frame
  2107. Oct 27 20:18:48 localhost vdr: video: decoder buffer empty, duping frame (644/86) 0 v-buf
  2108. Oct 27 20:18:48 localhost vdr: video: --:--:--.--- +0 0 0/\ms 0+5+4 v-buf
  2109. Oct 27 20:18:48 localhost epgd: Checking tvm id 60
  2110. Oct 27 20:18:48 localhost epgd: Checking tvm id 69
  2111. Oct 27 20:18:48 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2112. Oct 27 20:18:48 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2113. Oct 27 20:18:48 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2114. Oct 27 20:18:48 localhost vdr: [1799] switching to channel 14 S19.2E-1-1082-20002 (ProSieben Austria)
  2115. Oct 27 20:18:48 localhost vdr: [2730] osdteletext-receiver thread ended (pid=1799, tid=2730)
  2116. Oct 27 20:18:48 localhost vdr: [1799] buffer stats: 0 (0%) used
  2117. Oct 27 20:18:48 localhost epgd: Checking tvm id 7
  2118. Oct 27 20:18:48 localhost epgd: Checking tvm id 76
  2119. Oct 27 20:18:48 localhost vdr: [2731] device 1 TS buffer thread ended (pid=1799, tid=2731)
  2120. Oct 27 20:18:48 localhost vdr: [2729] buffer stats: 90428 (1%) used
  2121. Oct 27 20:18:48 localhost vdr: [2729] device 1 receiver thread ended (pid=1799, tid=2729)
  2122. Oct 27 20:18:48 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1082-20002
  2123. Oct 27 20:18:48 localhost vdr: [2736] osdteletext-receiver thread started (pid=1799, tid=2736, prio=high)
  2124. Oct 27 20:18:48 localhost vdr: [2735] device 1 receiver thread started (pid=1799, tid=2735, prio=high)
  2125. Oct 27 20:18:48 localhost vdr: [2737] device 1 TS buffer thread started (pid=1799, tid=2737, prio=high)
  2126. Oct 27 20:18:48 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2127. Oct 27 20:18:48 localhost epgd: Checking tvm id 8
  2128. Oct 27 20:18:48 localhost epgd: Checking tvm id 9
  2129. Oct 27 20:18:48 localhost vdr: audio/alsa: using device 'default'
  2130. Oct 27 20:18:48 localhost vdr: audio/alsa: start delay 600ms
  2131. Oct 27 20:18:48 localhost epgd: Updating 'tvsp' day today+0 now
  2132. Oct 27 20:18:49 localhost epgd: Downloaded '2NEO' for 2019-10-27 not changed, skipping.
  2133. Oct 27 20:18:49 localhost epgd: Downloaded '3SAT' for 2019-10-27 with (93373) Bytes, changed since last load.
  2134. Oct 27 20:18:49 localhost epgd: Downloaded 'ALPHA' for 2019-10-27 not changed, skipping.
  2135. Oct 27 20:18:49 localhost vdr: audio/alsa: using device 'default'
  2136. Oct 27 20:18:49 localhost vdr: audio/alsa: start delay 600ms
  2137. Oct 27 20:18:49 localhost epgd: Downloaded 'ANIXE' for 2019-10-27 not changed, skipping.
  2138. Oct 27 20:18:49 localhost epgd: Downloaded 'ARD' for 2019-10-27 with (77880) Bytes, changed since last load.
  2139. Oct 27 20:18:49 localhost epgd: Downloaded 'ARTE' for 2019-10-27 with (95330) Bytes, changed since last load.
  2140. Oct 27 20:18:50 localhost vdr: video: decoder buffer empty, duping frame (687/8) 3 v-buf
  2141. Oct 27 20:18:50 localhost vdr: video: slow down video, duping frame
  2142. Oct 27 20:18:50 localhost vdr: video: 24:13:19.359 +112 614 0/\ms 27+7+4 v-buf
  2143. Oct 27 20:18:50 localhost vdr: video/vdpau: synced after 66 frames
  2144. Oct 27 20:18:50 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2145. Oct 27 20:18:50 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2146. Oct 27 20:18:50 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2147. Oct 27 20:18:50 localhost vdr: [1799] switching to channel 13 S19.2E-1-1091-28800 (RTL Austria)
  2148. Oct 27 20:18:50 localhost vdr: [2736] osdteletext-receiver thread ended (pid=1799, tid=2736)
  2149. Oct 27 20:18:50 localhost vdr: [1799] buffer stats: 0 (0%) used
  2150. Oct 27 20:18:51 localhost vdr: [2737] device 1 TS buffer thread ended (pid=1799, tid=2737)
  2151. Oct 27 20:18:51 localhost vdr: [2735] buffer stats: 29140 (0%) used
  2152. Oct 27 20:18:51 localhost vdr: [2735] device 1 receiver thread ended (pid=1799, tid=2735)
  2153. Oct 27 20:18:51 localhost vdr: [2747] device 1 receiver thread started (pid=1799, tid=2747, prio=high)
  2154. Oct 27 20:18:51 localhost vdr: [2748] device 1 TS buffer thread started (pid=1799, tid=2748, prio=high)
  2155. Oct 27 20:18:51 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1091-28800
  2156. Oct 27 20:18:51 localhost vdr: [2749] osdteletext-receiver thread started (pid=1799, tid=2749, prio=high)
  2157. Oct 27 20:18:51 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2158. Oct 27 20:18:51 localhost epgd: Downloaded 'ATV' for 2019-10-27 with (34301) Bytes, changed since last load.
  2159. Oct 27 20:18:51 localhost vdr: audio/alsa: using device 'default'
  2160. Oct 27 20:18:51 localhost vdr: audio/alsa: start delay 600ms
  2161. Oct 27 20:18:51 localhost vdr: audio/alsa: using device 'default'
  2162. Oct 27 20:18:51 localhost vdr: audio/alsa: start delay 600ms
  2163. Oct 27 20:18:52 localhost epgd: Downloaded 'ATV2' for 2019-10-27 not changed, skipping.
  2164. Oct 27 20:18:52 localhost vdr: [1799] [softhddev]SetPlayMode: 0
  2165. Oct 27 20:18:52 localhost vdr: [1799] [softhddev]SetVideoDisplayFormat: 1
  2166. Oct 27 20:18:52 localhost vdr: [1799] [softhddev]GetSpuDecoder:
  2167. Oct 27 20:18:52 localhost vdr: [1799] switching to channel 12 S19.2E-1-1082-20005 (SAT.1 A)
  2168. Oct 27 20:18:52 localhost vdr: [2749] osdteletext-receiver thread ended (pid=1799, tid=2749)
  2169. Oct 27 20:18:52 localhost vdr: [1799] buffer stats: 0 (0%) used
  2170. Oct 27 20:18:52 localhost vdr: [2748] device 1 TS buffer thread ended (pid=1799, tid=2748)
  2171. Oct 27 20:18:52 localhost vdr: [2747] buffer stats: 93624 (1%) used
  2172. Oct 27 20:18:52 localhost vdr: [2747] device 1 receiver thread ended (pid=1799, tid=2747)
  2173. Oct 27 20:18:52 localhost vdr: [2755] device 1 receiver thread started (pid=1799, tid=2755, prio=high)
  2174. Oct 27 20:18:52 localhost vdr: [2756] device 1 TS buffer thread started (pid=1799, tid=2756, prio=high)
  2175. Oct 27 20:18:52 localhost vdr: [1799] creating directory /run/shm/vtx/S19.2E-1-1082-20005
  2176. Oct 27 20:18:52 localhost vdr: [2757] osdteletext-receiver thread started (pid=1799, tid=2757, prio=high)
  2177. Oct 27 20:18:52 localhost vdr: [1799] [softhddev]SetPlayMode: 1
  2178. Oct 27 20:18:52 localhost vdr: video: slow down video, duping frame
  2179. Oct 27 20:18:52 localhost vdr: video: decoder buffer empty, duping frame (692/18) 0 v-buf
  2180. Oct 27 20:18:52 localhost vdr: video: --:--:--.--- +0 0 0/\ms 0+5+4 v-buf
  2181. Oct 27 20:18:52 localhost epgd: Downloaded 'BBC' for 2019-10-27 not changed, skipping.
  2182. Oct 27 20:18:52 localhost vdr: audio/alsa: using device 'default'
  2183. Oct 27 20:18:52 localhost vdr: audio/alsa: start delay 600ms
  2184. Oct 27 20:18:53 localhost epgd: Downloaded 'BR-S' for 2019-10-27 with (75262) Bytes, changed since last load.
  2185. Oct 27 20:18:53 localhost vdr: video: decoder buffer empty, duping frame (732/18) 4 v-buf
  2186. Oct 27 20:18:53 localhost vdr: video: slow down video, duping frame
  2187. Oct 27 20:18:53 localhost vdr: video: 23:34:53.563 +119 615 0/\ms 12+7+4 v-buf
  2188. Oct 27 20:18:54 localhost vdr: video/vdpau: synced after 47 frames
  2189. Oct 27 20:18:54 localhost epgd: Downloaded 'CC' for 2019-10-27 with (97221) Bytes, changed since last load.
  2190. Oct 27 20:18:55 localhost epgd: Downloaded 'CNBC' for 2019-10-27 not changed, skipping.
  2191. Oct 27 20:18:55 localhost epgd: Downloaded 'DISNE' for 2019-10-27 with (71822) Bytes, changed since last load.
  2192. Oct 27 20:18:56 localhost epgd: Downloaded 'DMAX' for 2019-10-27 with (31742) Bytes, changed since last load.
  2193. Oct 27 20:18:57 localhost vdr: [2421] animator thread thread ended (pid=1799, tid=2421)
  2194. Oct 27 20:18:57 localhost epgd: Downloaded 'EURON' for 2019-10-27 not changed, skipping.
  2195. Oct 27 20:18:58 localhost epgd: Downloaded 'FES' for 2019-10-27 with (85942) Bytes, changed since last load.
  2196. Oct 27 20:18:59 localhost epgd: Downloaded 'HR' for 2019-10-27 with (66475) Bytes, changed since last load.
  2197. Oct 27 20:18:59 localhost epgd: Downloaded 'K1' for 2019-10-27 not changed, skipping.
  2198. Oct 27 20:19:00 localhost epgd: Downloaded 'K1DOKU' for 2019-10-27 not changed, skipping.
  2199. Oct 27 20:19:00 localhost epgd: Downloaded 'KIKA' for 2019-10-27 not changed, skipping.
  2200. Oct 27 20:19:00 localhost epgd: Downloaded 'MDR' for 2019-10-27 not changed, skipping.
  2201. Oct 27 20:19:01 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-27]
  2202. Oct 27 20:19:01 localhost epgd: Downloaded 'N24' for 2019-10-27 failed, code: 0.
  2203. Oct 27 20:19:01 localhost epgd: Downloaded 'N24DOKU' for 2019-10-27 not changed, skipping.
  2204. Oct 27 20:19:01 localhost epgd: Downloaded 'NDR-HH' for 2019-10-27 not changed, skipping.
  2205. Oct 27 20:19:01 localhost epgd: Downloaded 'NICK' for 2019-10-27 with (54122) Bytes, changed since last load.
  2206. Oct 27 20:19:02 localhost epgd: Downloaded 'NTV' for 2019-10-27 not changed, skipping.
  2207. Oct 27 20:19:02 localhost epgd: Downloaded 'OE24TV' for 2019-10-27 not changed, skipping.
  2208. Oct 27 20:19:02 localhost epgd: Downloaded 'ORF1' for 2019-10-27 with (63821) Bytes, changed since last load.
  2209. Oct 27 20:19:03 localhost epgd: Downloaded 'ORF2' for 2019-10-27 with (58323) Bytes, changed since last load.
  2210. Oct 27 20:19:05 localhost epgd: Downloaded 'ORF3' for 2019-10-27 not changed, skipping.
  2211. Oct 27 20:19:05 localhost epgd: Downloaded 'ORFSP' for 2019-10-27 not changed, skipping.
  2212. Oct 27 20:19:05 localhost epgd: Downloaded 'PHOEN' for 2019-10-27 not changed, skipping.
  2213. Oct 27 20:19:05 localhost epgd: Downloaded 'PRO7' for 2019-10-27 with (39032) Bytes, changed since last load.
  2214. Oct 27 20:19:06 localhost epgd: Downloaded 'PRO7M' for 2019-10-27 not changed, skipping.
  2215. Oct 27 20:19:07 localhost epgd: Downloaded 'PULS4' for 2019-10-27 with (47323) Bytes, changed since last load.
  2216. Oct 27 20:19:07 localhost epgd: Downloaded 'RB-TV' for 2019-10-27 not changed, skipping.
  2217. Oct 27 20:19:08 localhost systemd[1]: Starting Stop ureadahead data collection...
  2218. Oct 27 20:19:08 localhost systemd[1]: Started Stop ureadahead data collection.
  2219. Oct 27 20:19:08 localhost epgd: Downloaded 'RBB' for 2019-10-27 not changed, skipping.
  2220. Oct 27 20:19:09 localhost epgd: Downloaded 'RIC' for 2019-10-27 not changed, skipping.
  2221. Oct 27 20:19:10 localhost epgd: Downloaded 'RTL' for 2019-10-27 not changed, skipping.
  2222. Oct 27 20:19:10 localhost epgd: Downloaded 'RTL-N' for 2019-10-27 with (49245) Bytes, changed since last load.
  2223. Oct 27 20:19:11 localhost epgd: Downloaded 'RTL2' for 2019-10-27 with (43515) Bytes, changed since last load.
  2224. Oct 27 20:19:12 localhost epgd: Downloaded 'SAT1' for 2019-10-27 not changed, skipping.
  2225. Oct 27 20:19:12 localhost epgd: Downloaded 'SAT1G' for 2019-10-27 with (66298) Bytes, changed since last load.
  2226. Oct 27 20:19:13 localhost epgd: Downloaded 'SERVU' for 2019-10-27 not changed, skipping.
  2227. Oct 27 20:19:14 localhost vdr: epg2vdr: Trying to re-connect to database!
  2228. Oct 27 20:19:14 localhost vdr: epg2vdr: Info: Last update was at '26.10.19 21:33:14'
  2229. Oct 27 20:19:14 localhost vdr: epg2vdr: Handler: Start reading external ids from db
  2230. Oct 27 20:19:14 localhost vdr: epg2vdr: Handler: Finished reading external id's from db, got 180 id's
  2231. Oct 27 20:19:14 localhost vdr: epg2vdr: Connection established successfull!
  2232. Oct 27 20:19:14 localhost vdr: epg2vdr: Cleanup deleted recordings at database (forced)
  2233. Oct 27 20:19:14 localhost vdr: epg2vdr: Info: Marked 0 recordings as deleted
  2234. Oct 27 20:19:14 localhost vdr: epg2vdr: Updating recording list table
  2235. Oct 27 20:19:14 localhost epgd: Downloaded 'SIXX' for 2019-10-27 with (42294) Bytes, changed since last load.
  2236. Oct 27 20:19:15 localhost vdr: epg2vdr: Info: Found 256 recordings; 0 inserted; 77 updated and 53 directories
  2237. Oct 27 20:19:15 localhost vdr: epg2vdr: Detected epgd state 'busy (events)' (3)
  2238. Oct 27 20:19:15 localhost epgd: Downloaded 'SR' for 2019-10-27 with (88283) Bytes, changed since last load.
  2239. Oct 27 20:19:16 localhost epgd: Downloaded 'SUPER' for 2019-10-27 with (35687) Bytes, changed since last load.
  2240. Oct 27 20:19:16 localhost epgd: Downloaded 'SWRBW' for 2019-10-27 with (87853) Bytes, changed since last load.
  2241. Oct 27 20:19:18 localhost epgd: Downloaded 'TAG24' for 2019-10-27 not changed, skipping.
  2242. Oct 27 20:19:19 localhost epgd: Downloaded 'TELE5' for 2019-10-27 with (47433) Bytes, changed since last load.
  2243. Oct 27 20:19:20 localhost epgd: Downloaded 'TLC' for 2019-10-27 not changed, skipping.
  2244. Oct 27 20:19:21 localhost epgd: Downloaded 'TOGGO' for 2019-10-27 not changed, skipping.
  2245. Oct 27 20:19:21 localhost epgd: Downloaded 'VOX' for 2019-10-27 with (60528) Bytes, changed since last load.
  2246. Oct 27 20:19:23 localhost epgd: Downloaded 'WDR' for 2019-10-27 with (64038) Bytes, changed since last load.
  2247. Oct 27 20:19:24 localhost vdr: video: slow down video, duping frame
  2248. Oct 27 20:19:24 localhost vdr: video: speed up video, droping frame
  2249. Oct 27 20:19:24 localhost vdr: video: 23:35:23.963 -25 630 0/\ms 14+5+4 v-buf
  2250. Oct 27 20:19:25 localhost epgd: Downloaded 'WDWTV' for 2019-10-27 not changed, skipping.
  2251. Oct 27 20:19:25 localhost epgd: Downloaded 'ZDF' for 2019-10-27 with (116261) Bytes, changed since last load.
  2252. Oct 27 20:19:26 localhost epgd: Downloaded 'ZINFO' for 2019-10-27 not changed, skipping.
  2253. Oct 27 20:19:26 localhost epgd: Downloading images...
  2254. Oct 27 20:19:27 localhost epgd: Downloaded 1 images
  2255. Oct 27 20:19:27 localhost epgd: Updating 'tvm' day today+1 now
  2256. Oct 27 20:19:27 localhost epgd: Skipping day 1 for TVM plugin, since all days ar performed on day 0
  2257. Oct 27 20:19:27 localhost epgd: Updating 'tvsp' day today+1 now
  2258. Oct 27 20:19:27 localhost epgd: Downloaded '2NEO' for 2019-10-28 with (90983) Bytes, changed since last load.
  2259. Oct 27 20:19:27 localhost epgd: Downloaded '3SAT' for 2019-10-28 with (83614) Bytes, changed since last load.
  2260. Oct 27 20:19:28 localhost epgd: Downloaded 'ALPHA' for 2019-10-28 not changed, skipping.
  2261. Oct 27 20:19:28 localhost epgd: Downloaded 'ANIXE' for 2019-10-28 not changed, skipping.
  2262. Oct 27 20:19:28 localhost epgd: Downloaded 'ARD' for 2019-10-28 with (72632) Bytes, changed since last load.
  2263. Oct 27 20:19:29 localhost epgd: Downloaded 'ARTE' for 2019-10-28 with (81562) Bytes, changed since last load.
  2264. Oct 27 20:19:30 localhost epgd: Downloaded 'ATV' for 2019-10-28 with (48412) Bytes, changed since last load.
  2265. Oct 27 20:19:31 localhost epgd: Downloaded 'ATV2' for 2019-10-28 not changed, skipping.
  2266. Oct 27 20:19:31 localhost epgd: Downloaded 'BBC' for 2019-10-28 not changed, skipping.
  2267. Oct 27 20:19:31 localhost epgd: Downloaded 'BR-S' for 2019-10-28 with (79825) Bytes, changed since last load.
  2268. Oct 27 20:19:32 localhost epgd: Downloaded 'CC' for 2019-10-28 with (101887) Bytes, changed since last load.
  2269. Oct 27 20:19:32 localhost epgd: Downloaded 'CNBC' for 2019-10-28 not changed, skipping.
  2270. Oct 27 20:19:33 localhost epgd: Downloaded 'DISNE' for 2019-10-28 with (74069) Bytes, changed since last load.
  2271. Oct 27 20:19:33 localhost epgd: Downloaded 'DMAX' for 2019-10-28 with (34919) Bytes, changed since last load.
  2272. Oct 27 20:19:34 localhost epgd: Downloaded 'EURON' for 2019-10-28 not changed, skipping.
  2273. Oct 27 20:19:34 localhost epgd: Downloaded 'FES' for 2019-10-28 with (91635) Bytes, changed since last load.
  2274. Oct 27 20:19:34 localhost epgd: Downloaded 'HR' for 2019-10-28 with (70866) Bytes, changed since last load.
  2275. Oct 27 20:19:35 localhost epgd: Downloaded 'K1' for 2019-10-28 with (56201) Bytes, changed since last load.
  2276. Oct 27 20:19:35 localhost epgd: Downloaded 'K1DOKU' for 2019-10-28 not changed, skipping.
  2277. Oct 27 20:19:36 localhost epgd: Downloaded 'KIKA' for 2019-10-28 not changed, skipping.
  2278. Oct 27 20:19:36 localhost epgd: Downloaded 'MDR' for 2019-10-28 with (69039) Bytes, changed since last load.
  2279. Oct 27 20:19:37 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-28]
  2280. Oct 27 20:19:37 localhost epgd: Downloaded 'N24' for 2019-10-28 failed, code: 0.
  2281. Oct 27 20:19:37 localhost epgd: Downloaded 'N24DOKU' for 2019-10-28 not changed, skipping.
  2282. Oct 27 20:19:37 localhost epgd: Downloaded 'NDR-HH' for 2019-10-28 with (82337) Bytes, changed since last load.
  2283. Oct 27 20:19:38 localhost epgd: Downloaded 'NICK' for 2019-10-28 with (65384) Bytes, changed since last load.
  2284. Oct 27 20:19:39 localhost epgd: Downloaded 'NTV' for 2019-10-28 not changed, skipping.
  2285. Oct 27 20:19:39 localhost epgd: Downloaded 'OE24TV' for 2019-10-28 not changed, skipping.
  2286. Oct 27 20:19:40 localhost epgd: Downloaded 'ORF1' for 2019-10-28 with (107161) Bytes, changed since last load.
  2287. Oct 27 20:19:40 localhost epgd: Downloaded 'ORF2' for 2019-10-28 with (54679) Bytes, changed since last load.
  2288. Oct 27 20:19:42 localhost epgd: Downloaded 'ORF3' for 2019-10-28 not changed, skipping.
  2289. Oct 27 20:19:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2290. Oct 27 20:19:42 localhost epgd: Downloaded 'ORFSP' for 2019-10-28 not changed, skipping.
  2291. Oct 27 20:19:42 localhost epgd: Downloaded 'PHOEN' for 2019-10-28 not changed, skipping.
  2292. Oct 27 20:19:43 localhost epgd: Downloaded 'PRO7' for 2019-10-28 with (106261) Bytes, changed since last load.
  2293. Oct 27 20:19:44 localhost epgd: Downloaded 'PRO7M' for 2019-10-28 with (58358) Bytes, changed since last load.
  2294. Oct 27 20:19:44 localhost epgd: Downloaded 'PULS4' for 2019-10-28 not changed, skipping.
  2295. Oct 27 20:19:44 localhost epgd: Downloaded 'RB-TV' for 2019-10-28 with (85215) Bytes, changed since last load.
  2296. Oct 27 20:19:45 localhost epgd: Downloaded 'RBB' for 2019-10-28 with (73069) Bytes, changed since last load.
  2297. Oct 27 20:19:45 localhost epgd: Downloaded 'RIC' for 2019-10-28 not changed, skipping.
  2298. Oct 27 20:19:45 localhost epgd: Downloaded 'RTL' for 2019-10-28 not changed, skipping.
  2299. Oct 27 20:19:46 localhost epgd: Downloaded 'RTL-N' for 2019-10-28 with (48271) Bytes, changed since last load.
  2300. Oct 27 20:19:46 localhost epgd: Downloaded 'RTL2' for 2019-10-28 not changed, skipping.
  2301. Oct 27 20:19:46 localhost epgd: Downloaded 'SAT1' for 2019-10-28 not changed, skipping.
  2302. Oct 27 20:19:46 localhost epgd: Downloaded 'SAT1G' for 2019-10-28 with (54441) Bytes, changed since last load.
  2303. Oct 27 20:19:47 localhost epgd: Downloaded 'SERVU' for 2019-10-28 not changed, skipping.
  2304. Oct 27 20:19:47 localhost epgd: Downloaded 'SIXX' for 2019-10-28 with (60156) Bytes, changed since last load.
  2305. Oct 27 20:19:47 localhost epgd: Downloaded 'SR' for 2019-10-28 not changed, skipping.
  2306. Oct 27 20:19:47 localhost epgd: Downloaded 'SUPER' for 2019-10-28 not changed, skipping.
  2307. Oct 27 20:19:48 localhost epgd: Downloaded 'SWRBW' for 2019-10-28 not changed, skipping.
  2308. Oct 27 20:19:48 localhost epgd: Downloaded 'TAG24' for 2019-10-28 not changed, skipping.
  2309. Oct 27 20:19:48 localhost epgd: Downloaded 'TELE5' for 2019-10-28 with (56873) Bytes, changed since last load.
  2310. Oct 27 20:19:48 localhost epgd: Downloaded 'TLC' for 2019-10-28 not changed, skipping.
  2311. Oct 27 20:19:49 localhost epgd: Downloaded 'TOGGO' for 2019-10-28 not changed, skipping.
  2312. Oct 27 20:19:49 localhost epgd: Downloaded 'VOX' for 2019-10-28 with (52555) Bytes, changed since last load.
  2313. Oct 27 20:19:49 localhost epgd: Downloaded 'WDR' for 2019-10-28 with (74911) Bytes, changed since last load.
  2314. Oct 27 20:19:51 localhost epgd: Downloaded 'WDWTV' for 2019-10-28 not changed, skipping.
  2315. Oct 27 20:19:51 localhost epgd: Downloaded 'ZDF' for 2019-10-28 with (68953) Bytes, changed since last load.
  2316. Oct 27 20:19:52 localhost epgd: Downloaded 'ZINFO' for 2019-10-28 not changed, skipping.
  2317. Oct 27 20:19:52 localhost epgd: Downloading images...
  2318. Oct 27 20:19:53 localhost vdr: video: 23:35:52.723 +12 580 0/\ms 12+6+4 v-buf
  2319. Oct 27 20:19:53 localhost epgd: Downloaded 2 images
  2320. Oct 27 20:19:53 localhost epgd: Updating 'tvm' day today+2 now
  2321. Oct 27 20:19:53 localhost epgd: Skipping day 2 for TVM plugin, since all days ar performed on day 0
  2322. Oct 27 20:19:53 localhost epgd: Updating 'tvsp' day today+2 now
  2323. Oct 27 20:19:54 localhost epgd: Downloaded '2NEO' for 2019-10-29 with (106390) Bytes, changed since last load.
  2324. Oct 27 20:19:54 localhost epgd: Downloaded '3SAT' for 2019-10-29 not changed, skipping.
  2325. Oct 27 20:19:55 localhost epgd: Downloaded 'ALPHA' for 2019-10-29 not changed, skipping.
  2326. Oct 27 20:19:55 localhost vdr: epg2vdr: Handler: Init handler instance for thread 1932
  2327. Oct 27 20:19:55 localhost epgd: Downloaded 'ANIXE' for 2019-10-29 with (45551) Bytes, changed since last load.
  2328. Oct 27 20:19:55 localhost epgd: Downloaded 'ARD' for 2019-10-29 with (75749) Bytes, changed since last load.
  2329. Oct 27 20:19:56 localhost epgd: Downloaded 'ARTE' for 2019-10-29 with (87574) Bytes, changed since last load.
  2330. Oct 27 20:19:57 localhost epgd: Downloaded 'ATV' for 2019-10-29 not changed, skipping.
  2331. Oct 27 20:19:57 localhost epgd: Downloaded 'ATV2' for 2019-10-29 with (42612) Bytes, changed since last load.
  2332. Oct 27 20:19:57 localhost epgd: Downloaded 'BBC' for 2019-10-29 not changed, skipping.
  2333. Oct 27 20:19:58 localhost epgd: Downloaded 'BR-S' for 2019-10-29 with (73589) Bytes, changed since last load.
  2334. Oct 27 20:19:58 localhost epgd: Downloaded 'CC' for 2019-10-29 with (102867) Bytes, changed since last load.
  2335. Oct 27 20:19:58 localhost epgd: Downloaded 'CNBC' for 2019-10-29 not changed, skipping.
  2336. Oct 27 20:19:59 localhost epgd: Downloaded 'DISNE' for 2019-10-29 with (79460) Bytes, changed since last load.
  2337. Oct 27 20:19:59 localhost epgd: Downloaded 'DMAX' for 2019-10-29 with (38741) Bytes, changed since last load.
  2338. Oct 27 20:20:00 localhost epgd: Downloaded 'EURON' for 2019-10-29 not changed, skipping.
  2339. Oct 27 20:20:00 localhost epgd: Downloaded 'FES' for 2019-10-29 with (96502) Bytes, changed since last load.
  2340. Oct 27 20:20:01 localhost epgd: Downloaded 'HR' for 2019-10-29 with (80006) Bytes, changed since last load.
  2341. Oct 27 20:20:02 localhost epgd: Downloaded 'K1' for 2019-10-29 with (58200) Bytes, changed since last load.
  2342. Oct 27 20:20:02 localhost epgd: Downloaded 'K1DOKU' for 2019-10-29 not changed, skipping.
  2343. Oct 27 20:20:02 localhost epgd: Downloaded 'KIKA' for 2019-10-29 not changed, skipping.
  2344. Oct 27 20:20:03 localhost epgd: Downloaded 'MDR' for 2019-10-29 with (75760) Bytes, changed since last load.
  2345. Oct 27 20:20:03 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-29]
  2346. Oct 27 20:20:03 localhost epgd: Downloaded 'N24' for 2019-10-29 failed, code: 0.
  2347. Oct 27 20:20:04 localhost epgd: Downloaded 'N24DOKU' for 2019-10-29 not changed, skipping.
  2348. Oct 27 20:20:05 localhost epgd: Downloaded 'NDR-HH' for 2019-10-29 with (73911) Bytes, changed since last load.
  2349. Oct 27 20:20:06 localhost epgd: Downloaded 'NICK' for 2019-10-29 with (63412) Bytes, changed since last load.
  2350. Oct 27 20:20:06 localhost epgd: Downloaded 'NTV' for 2019-10-29 not changed, skipping.
  2351. Oct 27 20:20:06 localhost epgd: Downloaded 'OE24TV' for 2019-10-29 not changed, skipping.
  2352. Oct 27 20:20:07 localhost epgd: Downloaded 'ORF1' for 2019-10-29 with (111616) Bytes, changed since last load.
  2353. Oct 27 20:20:07 localhost epgd: Downloaded 'ORF2' for 2019-10-29 with (54723) Bytes, changed since last load.
  2354. Oct 27 20:20:09 localhost epgd: Downloaded 'ORF3' for 2019-10-29 not changed, skipping.
  2355. Oct 27 20:20:09 localhost epgd: Downloaded 'ORFSP' for 2019-10-29 not changed, skipping.
  2356. Oct 27 20:20:09 localhost epgd: Downloaded 'PHOEN' for 2019-10-29 not changed, skipping.
  2357. Oct 27 20:20:09 localhost epgd: Downloaded 'PRO7' for 2019-10-29 with (101107) Bytes, changed since last load.
  2358. Oct 27 20:20:10 localhost epgd: Downloaded 'PRO7M' for 2019-10-29 with (49920) Bytes, changed since last load.
  2359. Oct 27 20:20:10 localhost epgd: Downloaded 'PULS4' for 2019-10-29 not changed, skipping.
  2360. Oct 27 20:20:10 localhost epgd: Downloaded 'RB-TV' for 2019-10-29 with (76715) Bytes, changed since last load.
  2361. Oct 27 20:20:11 localhost epgd: Downloaded 'RBB' for 2019-10-29 with (70361) Bytes, changed since last load.
  2362. Oct 27 20:20:12 localhost epgd: Downloaded 'RIC' for 2019-10-29 not changed, skipping.
  2363. Oct 27 20:20:12 localhost epgd: Downloaded 'RTL' for 2019-10-29 with (37621) Bytes, changed since last load.
  2364. Oct 27 20:20:13 localhost epgd: Downloaded 'RTL-N' for 2019-10-29 with (59265) Bytes, changed since last load.
  2365. Oct 27 20:20:13 localhost epgd: Downloaded 'RTL2' for 2019-10-29 not changed, skipping.
  2366. Oct 27 20:20:14 localhost epgd: Downloaded 'SAT1' for 2019-10-29 not changed, skipping.
  2367. Oct 27 20:20:14 localhost epgd: Downloaded 'SAT1G' for 2019-10-29 with (63983) Bytes, changed since last load.
  2368. Oct 27 20:20:15 localhost epgd: Downloaded 'SERVU' for 2019-10-29 with (61798) Bytes, changed since last load.
  2369. Oct 27 20:20:15 localhost vdr: epg2vdr: Update info.epg2vdr recordings
  2370. Oct 27 20:20:15 localhost vdr: epg2vdr: Updated 0 info.epg2vdr files
  2371. Oct 27 20:20:15 localhost epgd: Downloaded 'SIXX' for 2019-10-29 with (65838) Bytes, changed since last load.
  2372. Oct 27 20:20:15 localhost epgd: Downloaded 'SR' for 2019-10-29 not changed, skipping.
  2373. Oct 27 20:20:15 localhost epgd: Downloaded 'SUPER' for 2019-10-29 not changed, skipping.
  2374. Oct 27 20:20:15 localhost epgd: Downloaded 'SWRBW' for 2019-10-29 not changed, skipping.
  2375. Oct 27 20:20:16 localhost epgd: Downloaded 'TAG24' for 2019-10-29 not changed, skipping.
  2376. Oct 27 20:20:16 localhost epgd: Downloaded 'TELE5' for 2019-10-29 with (57365) Bytes, changed since last load.
  2377. Oct 27 20:20:16 localhost epgd: Downloaded 'TLC' for 2019-10-29 not changed, skipping.
  2378. Oct 27 20:20:16 localhost epgd: Downloaded 'TOGGO' for 2019-10-29 not changed, skipping.
  2379. Oct 27 20:20:17 localhost epgd: Downloaded 'VOX' for 2019-10-29 with (51367) Bytes, changed since last load.
  2380. Oct 27 20:20:17 localhost epgd: Downloaded 'WDR' for 2019-10-29 not changed, skipping.
  2381. Oct 27 20:20:18 localhost epgd: Downloaded 'WDWTV' for 2019-10-29 not changed, skipping.
  2382. Oct 27 20:20:18 localhost epgd: Downloaded 'ZDF' for 2019-10-29 with (72695) Bytes, changed since last load.
  2383. Oct 27 20:20:19 localhost epgd: Downloaded 'ZINFO' for 2019-10-29 not changed, skipping.
  2384. Oct 27 20:20:19 localhost epgd: Downloading images...
  2385. Oct 27 20:20:19 localhost epgd: Downloaded 1 images
  2386. Oct 27 20:20:19 localhost epgd: Updating 'tvm' day today+3 now
  2387. Oct 27 20:20:19 localhost epgd: Skipping day 3 for TVM plugin, since all days ar performed on day 0
  2388. Oct 27 20:20:19 localhost epgd: Updating 'tvsp' day today+3 now
  2389. Oct 27 20:20:20 localhost epgd: Downloaded '2NEO' for 2019-10-30 with (114138) Bytes, changed since last load.
  2390. Oct 27 20:20:20 localhost epgd: Downloaded '3SAT' for 2019-10-30 with (90297) Bytes, changed since last load.
  2391. Oct 27 20:20:21 localhost epgd: Downloaded 'ALPHA' for 2019-10-30 not changed, skipping.
  2392. Oct 27 20:20:21 localhost epgd: Downloaded 'ANIXE' for 2019-10-30 with (47735) Bytes, changed since last load.
  2393. Oct 27 20:20:22 localhost epgd: Downloaded 'ARD' for 2019-10-30 with (70686) Bytes, changed since last load.
  2394. Oct 27 20:20:22 localhost epgd: Downloaded 'ARTE' for 2019-10-30 with (82344) Bytes, changed since last load.
  2395. Oct 27 20:20:23 localhost epgd: Downloaded 'ATV' for 2019-10-30 not changed, skipping.
  2396. Oct 27 20:20:23 localhost epgd: Downloaded 'ATV2' for 2019-10-30 not changed, skipping.
  2397. Oct 27 20:20:24 localhost epgd: Downloaded 'BBC' for 2019-10-30 not changed, skipping.
  2398. Oct 27 20:20:25 localhost epgd: Downloaded 'BR-S' for 2019-10-30 with (83658) Bytes, changed since last load.
  2399. Oct 27 20:20:25 localhost epgd: Downloaded 'CC' for 2019-10-30 with (100718) Bytes, changed since last load.
  2400. Oct 27 20:20:26 localhost epgd: Downloaded 'CNBC' for 2019-10-30 not changed, skipping.
  2401. Oct 27 20:20:26 localhost epgd: Downloaded 'DISNE' for 2019-10-30 with (79841) Bytes, changed since last load.
  2402. Oct 27 20:20:27 localhost epgd: Downloaded 'DMAX' for 2019-10-30 with (35691) Bytes, changed since last load.
  2403. Oct 27 20:20:27 localhost epgd: Downloaded 'EURON' for 2019-10-30 not changed, skipping.
  2404. Oct 27 20:20:28 localhost epgd: Downloaded 'FES' for 2019-10-30 with (89955) Bytes, changed since last load.
  2405. Oct 27 20:20:28 localhost epgd: Downloaded 'HR' for 2019-10-30 with (81383) Bytes, changed since last load.
  2406. Oct 27 20:20:28 localhost epgd: Downloaded 'K1' for 2019-10-30 with (63298) Bytes, changed since last load.
  2407. Oct 27 20:20:29 localhost epgd: Downloaded 'K1DOKU' for 2019-10-30 not changed, skipping.
  2408. Oct 27 20:20:29 localhost epgd: Downloaded 'KIKA' for 2019-10-30 not changed, skipping.
  2409. Oct 27 20:20:30 localhost epgd: Downloaded 'MDR' for 2019-10-30 with (77792) Bytes, changed since last load.
  2410. Oct 27 20:20:30 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-30]
  2411. Oct 27 20:20:30 localhost epgd: Downloaded 'N24' for 2019-10-30 failed, code: 0.
  2412. Oct 27 20:20:31 localhost epgd: Downloaded 'N24DOKU' for 2019-10-30 not changed, skipping.
  2413. Oct 27 20:20:32 localhost epgd: Downloaded 'NDR-HH' for 2019-10-30 with (79852) Bytes, changed since last load.
  2414. Oct 27 20:20:33 localhost epgd: Downloaded 'NICK' for 2019-10-30 with (64460) Bytes, changed since last load.
  2415. Oct 27 20:20:34 localhost epgd: Downloaded 'NTV' for 2019-10-30 not changed, skipping.
  2416. Oct 27 20:20:34 localhost epgd: Downloaded 'OE24TV' for 2019-10-30 not changed, skipping.
  2417. Oct 27 20:20:34 localhost epgd: Downloaded 'ORF1' for 2019-10-30 with (94215) Bytes, changed since last load.
  2418. Oct 27 20:20:35 localhost epgd: Downloaded 'ORF2' for 2019-10-30 with (60923) Bytes, changed since last load.
  2419. Oct 27 20:20:36 localhost epgd: Downloaded 'ORF3' for 2019-10-30 not changed, skipping.
  2420. Oct 27 20:20:37 localhost epgd: Downloaded 'ORFSP' for 2019-10-30 not changed, skipping.
  2421. Oct 27 20:20:37 localhost epgd: Downloaded 'PHOEN' for 2019-10-30 not changed, skipping.
  2422. Oct 27 20:20:38 localhost epgd: Downloaded 'PRO7' for 2019-10-30 with (104497) Bytes, changed since last load.
  2423. Oct 27 20:20:39 localhost epgd: Downloaded 'PRO7M' for 2019-10-30 with (57705) Bytes, changed since last load.
  2424. Oct 27 20:20:40 localhost epgd: Downloaded 'PULS4' for 2019-10-30 not changed, skipping.
  2425. Oct 27 20:20:41 localhost epgd: Downloaded 'RB-TV' for 2019-10-30 with (82663) Bytes, changed since last load.
  2426. Oct 27 20:20:42 localhost epgd: Downloaded 'RBB' for 2019-10-30 with (68129) Bytes, changed since last load.
  2427. Oct 27 20:20:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2428. Oct 27 20:20:42 localhost epgd: Downloaded 'RIC' for 2019-10-30 not changed, skipping.
  2429. Oct 27 20:20:43 localhost epgd: Downloaded 'RTL' for 2019-10-30 with (39289) Bytes, changed since last load.
  2430. Oct 27 20:20:44 localhost epgd: Downloaded 'RTL-N' for 2019-10-30 with (60593) Bytes, changed since last load.
  2431. Oct 27 20:20:45 localhost epgd: Downloaded 'RTL2' for 2019-10-30 not changed, skipping.
  2432. Oct 27 20:20:45 localhost epgd: Downloaded 'SAT1' for 2019-10-30 not changed, skipping.
  2433. Oct 27 20:20:46 localhost epgd: Downloaded 'SAT1G' for 2019-10-30 with (76505) Bytes, changed since last load.
  2434. Oct 27 20:20:47 localhost epgd: Downloaded 'SERVU' for 2019-10-30 not changed, skipping.
  2435. Oct 27 20:20:47 localhost epgd: Downloaded 'SIXX' for 2019-10-30 with (50599) Bytes, changed since last load.
  2436. Oct 27 20:20:48 localhost epgd: Downloaded 'SR' for 2019-10-30 not changed, skipping.
  2437. Oct 27 20:20:48 localhost epgd: Downloaded 'SUPER' for 2019-10-30 not changed, skipping.
  2438. Oct 27 20:20:48 localhost epgd: Downloaded 'SWRBW' for 2019-10-30 not changed, skipping.
  2439. Oct 27 20:20:48 localhost epgd: Downloaded 'TAG24' for 2019-10-30 not changed, skipping.
  2440. Oct 27 20:20:49 localhost epgd: Downloaded 'TELE5' for 2019-10-30 with (51152) Bytes, changed since last load.
  2441. Oct 27 20:20:50 localhost epgd: Downloaded 'TLC' for 2019-10-30 not changed, skipping.
  2442. Oct 27 20:20:51 localhost epgd: Downloaded 'TOGGO' for 2019-10-30 not changed, skipping.
  2443. Oct 27 20:20:52 localhost epgd: Downloaded 'VOX' for 2019-10-30 with (59738) Bytes, changed since last load.
  2444. Oct 27 20:20:53 localhost vdr: video: 23:36:52.723 +13 581 0/\ms 11+6+4 v-buf
  2445. Oct 27 20:20:53 localhost epgd: Downloaded 'WDR' for 2019-10-30 not changed, skipping.
  2446. Oct 27 20:20:54 localhost epgd: Downloaded 'WDWTV' for 2019-10-30 not changed, skipping.
  2447. Oct 27 20:20:56 localhost epgd: Downloaded 'ZDF' for 2019-10-30 with (85625) Bytes, changed since last load.
  2448. Oct 27 20:20:57 localhost epgd: Downloaded 'ZINFO' for 2019-10-30 not changed, skipping.
  2449. Oct 27 20:20:57 localhost epgd: Downloading images...
  2450. Oct 27 20:20:57 localhost epgd: Downloaded 0 images
  2451. Oct 27 20:20:57 localhost epgd: Updating 'tvm' day today+4 now
  2452. Oct 27 20:20:57 localhost epgd: Skipping day 4 for TVM plugin, since all days ar performed on day 0
  2453. Oct 27 20:20:57 localhost epgd: Updating 'tvsp' day today+4 now
  2454. Oct 27 20:20:57 localhost epgd: Downloaded '2NEO' for 2019-10-31 with (111990) Bytes, changed since last load.
  2455. Oct 27 20:20:58 localhost epgd: Downloaded '3SAT' for 2019-10-31 not changed, skipping.
  2456. Oct 27 20:20:58 localhost epgd: Downloaded 'ALPHA' for 2019-10-31 not changed, skipping.
  2457. Oct 27 20:20:58 localhost epgd: Downloaded 'ANIXE' for 2019-10-31 not changed, skipping.
  2458. Oct 27 20:20:59 localhost epgd: Downloaded 'ARD' for 2019-10-31 with (69409) Bytes, changed since last load.
  2459. Oct 27 20:21:00 localhost epgd: Downloaded 'ARTE' for 2019-10-31 with (94117) Bytes, changed since last load.
  2460. Oct 27 20:21:00 localhost epgd: Downloaded 'ATV' for 2019-10-31 not changed, skipping.
  2461. Oct 27 20:21:00 localhost epgd: Downloaded 'ATV2' for 2019-10-31 not changed, skipping.
  2462. Oct 27 20:21:00 localhost epgd: Downloaded 'BBC' for 2019-10-31 not changed, skipping.
  2463. Oct 27 20:21:00 localhost epgd: Downloaded 'BR-S' for 2019-10-31 with (78968) Bytes, changed since last load.
  2464. Oct 27 20:21:01 localhost epgd: Downloaded 'CC' for 2019-10-31 with (103145) Bytes, changed since last load.
  2465. Oct 27 20:21:01 localhost epgd: Downloaded 'CNBC' for 2019-10-31 not changed, skipping.
  2466. Oct 27 20:21:01 localhost epgd: Downloaded 'DISNE' for 2019-10-31 with (79541) Bytes, changed since last load.
  2467. Oct 27 20:21:01 localhost epgd: Downloaded 'DMAX' for 2019-10-31 with (33113) Bytes, changed since last load.
  2468. Oct 27 20:21:02 localhost epgd: Downloaded 'EURON' for 2019-10-31 not changed, skipping.
  2469. Oct 27 20:21:02 localhost epgd: Downloaded 'FES' for 2019-10-31 with (107639) Bytes, changed since last load.
  2470. Oct 27 20:21:02 localhost epgd: Downloaded 'HR' for 2019-10-31 with (76626) Bytes, changed since last load.
  2471. Oct 27 20:21:02 localhost epgd: Downloaded 'K1' for 2019-10-31 with (46051) Bytes, changed since last load.
  2472. Oct 27 20:21:03 localhost epgd: Downloaded 'K1DOKU' for 2019-10-31 not changed, skipping.
  2473. Oct 27 20:21:03 localhost epgd: Downloaded 'KIKA' for 2019-10-31 not changed, skipping.
  2474. Oct 27 20:21:03 localhost epgd: Downloaded 'MDR' for 2019-10-31 with (76255) Bytes, changed since last load.
  2475. Oct 27 20:21:04 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-10-31]
  2476. Oct 27 20:21:04 localhost epgd: Downloaded 'N24' for 2019-10-31 failed, code: 0.
  2477. Oct 27 20:21:04 localhost epgd: Downloaded 'N24DOKU' for 2019-10-31 not changed, skipping.
  2478. Oct 27 20:21:05 localhost epgd: Downloaded 'NDR-HH' for 2019-10-31 with (81994) Bytes, changed since last load.
  2479. Oct 27 20:21:06 localhost epgd: Downloaded 'NICK' for 2019-10-31 with (59266) Bytes, changed since last load.
  2480. Oct 27 20:21:06 localhost epgd: Downloaded 'NTV' for 2019-10-31 not changed, skipping.
  2481. Oct 27 20:21:06 localhost epgd: Downloaded 'OE24TV' for 2019-10-31 not changed, skipping.
  2482. Oct 27 20:21:06 localhost epgd: Downloaded 'ORF1' for 2019-10-31 with (100383) Bytes, changed since last load.
  2483. Oct 27 20:21:06 localhost epgd: Downloaded 'ORF2' for 2019-10-31 with (55031) Bytes, changed since last load.
  2484. Oct 27 20:21:07 localhost epgd: Downloaded 'ORF3' for 2019-10-31 not changed, skipping.
  2485. Oct 27 20:21:08 localhost epgd: Downloaded 'ORFSP' for 2019-10-31 not changed, skipping.
  2486. Oct 27 20:21:08 localhost epgd: Downloaded 'PHOEN' for 2019-10-31 not changed, skipping.
  2487. Oct 27 20:21:08 localhost epgd: Downloaded 'PRO7' for 2019-10-31 with (85610) Bytes, changed since last load.
  2488. Oct 27 20:21:08 localhost epgd: Downloaded 'PRO7M' for 2019-10-31 with (47898) Bytes, changed since last load.
  2489. Oct 27 20:21:08 localhost epgd: Downloaded 'PULS4' for 2019-10-31 not changed, skipping.
  2490. Oct 27 20:21:08 localhost epgd: Downloaded 'RB-TV' for 2019-10-31 with (82666) Bytes, changed since last load.
  2491. Oct 27 20:21:09 localhost epgd: Downloaded 'RBB' for 2019-10-31 with (63772) Bytes, changed since last load.
  2492. Oct 27 20:21:10 localhost epgd: Downloaded 'RIC' for 2019-10-31 not changed, skipping.
  2493. Oct 27 20:21:10 localhost epgd: Downloaded 'RTL' for 2019-10-31 not changed, skipping.
  2494. Oct 27 20:21:11 localhost epgd: Downloaded 'RTL-N' for 2019-10-31 with (50506) Bytes, changed since last load.
  2495. Oct 27 20:21:12 localhost epgd: Downloaded 'RTL2' for 2019-10-31 with (36474) Bytes, changed since last load.
  2496. Oct 27 20:21:12 localhost epgd: Downloaded 'SAT1' for 2019-10-31 with (40544) Bytes, changed since last load.
  2497. Oct 27 20:21:13 localhost epgd: Downloaded 'SAT1G' for 2019-10-31 with (71563) Bytes, changed since last load.
  2498. Oct 27 20:21:13 localhost epgd: Downloaded 'SERVU' for 2019-10-31 with (53926) Bytes, changed since last load.
  2499. Oct 27 20:21:14 localhost epgd: Downloaded 'SIXX' for 2019-10-31 with (59157) Bytes, changed since last load.
  2500. Oct 27 20:21:15 localhost epgd: Downloaded 'SR' for 2019-10-31 not changed, skipping.
  2501. Oct 27 20:21:15 localhost epgd: Downloaded 'SUPER' for 2019-10-31 with (43250) Bytes, changed since last load.
  2502. Oct 27 20:21:15 localhost epgd: Downloaded 'SWRBW' for 2019-10-31 not changed, skipping.
  2503. Oct 27 20:21:15 localhost epgd: Downloaded 'TAG24' for 2019-10-31 not changed, skipping.
  2504. Oct 27 20:21:15 localhost epgd: Downloaded 'TELE5' for 2019-10-31 with (55216) Bytes, changed since last load.
  2505. Oct 27 20:21:16 localhost epgd: Downloaded 'TLC' for 2019-10-31 not changed, skipping.
  2506. Oct 27 20:21:16 localhost epgd: Downloaded 'TOGGO' for 2019-10-31 not changed, skipping.
  2507. Oct 27 20:21:16 localhost epgd: Downloaded 'VOX' for 2019-10-31 with (55246) Bytes, changed since last load.
  2508. Oct 27 20:21:16 localhost epgd: Downloaded 'WDR' for 2019-10-31 with (61211) Bytes, changed since last load.
  2509. Oct 27 20:21:17 localhost epgd: Downloaded 'WDWTV' for 2019-10-31 not changed, skipping.
  2510. Oct 27 20:21:17 localhost epgd: Downloaded 'ZDF' for 2019-10-31 with (92024) Bytes, changed since last load.
  2511. Oct 27 20:21:18 localhost epgd: Downloaded 'ZINFO' for 2019-10-31 with (110554) Bytes, changed since last load.
  2512. Oct 27 20:21:18 localhost epgd: Downloading images...
  2513. Oct 27 20:21:18 localhost epgd: Downloaded 1 images
  2514. Oct 27 20:21:18 localhost epgd: Updating 'tvm' day today+5 now
  2515. Oct 27 20:21:18 localhost epgd: Skipping day 5 for TVM plugin, since all days ar performed on day 0
  2516. Oct 27 20:21:18 localhost epgd: Updating 'tvsp' day today+5 now
  2517. Oct 27 20:21:18 localhost epgd: Downloaded '2NEO' for 2019-11-01 with (111217) Bytes, changed since last load.
  2518. Oct 27 20:21:19 localhost epgd: Downloaded '3SAT' for 2019-11-01 not changed, skipping.
  2519. Oct 27 20:21:19 localhost epgd: Downloaded 'ALPHA' for 2019-11-01 with (65159) Bytes, changed since last load.
  2520. Oct 27 20:21:19 localhost epgd: Downloaded 'ANIXE' for 2019-11-01 with (43146) Bytes, changed since last load.
  2521. Oct 27 20:21:19 localhost epgd: Downloaded 'ARD' for 2019-11-01 with (66946) Bytes, changed since last load.
  2522. Oct 27 20:21:20 localhost epgd: Downloaded 'ARTE' for 2019-11-01 with (71487) Bytes, changed since last load.
  2523. Oct 27 20:21:20 localhost epgd: Downloaded 'ATV' for 2019-11-01 with (48749) Bytes, changed since last load.
  2524. Oct 27 20:21:20 localhost epgd: Downloaded 'ATV2' for 2019-11-01 with (43623) Bytes, changed since last load.
  2525. Oct 27 20:21:23 localhost epgd: Downloaded 'BBC' for 2019-11-01 not changed, skipping.
  2526. Oct 27 20:21:23 localhost epgd: Downloaded 'BR-S' for 2019-11-01 not changed, skipping.
  2527. Oct 27 20:21:24 localhost epgd: Downloaded 'CC' for 2019-11-01 with (102408) Bytes, changed since last load.
  2528. Oct 27 20:21:25 localhost epgd: Downloaded 'CNBC' for 2019-11-01 not changed, skipping.
  2529. Oct 27 20:21:26 localhost epgd: Downloaded 'DISNE' for 2019-11-01 with (73592) Bytes, changed since last load.
  2530. Oct 27 20:21:28 localhost epgd: Downloaded 'DMAX' for 2019-11-01 with (33237) Bytes, changed since last load.
  2531. Oct 27 20:21:29 localhost epgd: Downloaded 'EURON' for 2019-11-01 not changed, skipping.
  2532. Oct 27 20:21:29 localhost epgd: Downloaded 'FES' for 2019-11-01 with (89067) Bytes, changed since last load.
  2533. Oct 27 20:21:32 localhost epgd: Downloaded 'HR' for 2019-11-01 with (71032) Bytes, changed since last load.
  2534. Oct 27 20:21:34 localhost epgd: Downloaded 'K1' for 2019-11-01 with (48061) Bytes, changed since last load.
  2535. Oct 27 20:21:35 localhost epgd: Downloaded 'K1DOKU' for 2019-11-01 not changed, skipping.
  2536. Oct 27 20:21:36 localhost epgd: Downloaded 'KIKA' for 2019-11-01 with (186587) Bytes, changed since last load.
  2537. Oct 27 20:21:39 localhost epgd: Downloaded 'MDR' for 2019-11-01 with (84507) Bytes, changed since last load.
  2538. Oct 27 20:21:40 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-11-01]
  2539. Oct 27 20:21:40 localhost epgd: Downloaded 'N24' for 2019-11-01 failed, code: 0.
  2540. Oct 27 20:21:40 localhost epgd: Downloaded 'N24DOKU' for 2019-11-01 not changed, skipping.
  2541. Oct 27 20:21:40 localhost epgd: Downloaded 'NDR-HH' for 2019-11-01 with (77519) Bytes, changed since last load.
  2542. Oct 27 20:21:41 localhost epgd: Downloaded 'NICK' for 2019-11-01 with (57635) Bytes, changed since last load.
  2543. Oct 27 20:21:41 localhost epgd: Downloaded 'NTV' for 2019-11-01 not changed, skipping.
  2544. Oct 27 20:21:41 localhost epgd: Downloaded 'OE24TV' for 2019-11-01 not changed, skipping.
  2545. Oct 27 20:21:41 localhost epgd: Downloaded 'ORF1' for 2019-11-01 with (76499) Bytes, changed since last load.
  2546. Oct 27 20:21:42 localhost epgd: Downloaded 'ORF2' for 2019-11-01 not changed, skipping.
  2547. Oct 27 20:21:42 localhost epgd: Downloaded 'ORF3' for 2019-11-01 with (34961) Bytes, changed since last load.
  2548. Oct 27 20:21:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2549. Oct 27 20:21:43 localhost epgd: Downloaded 'ORFSP' for 2019-11-01 not changed, skipping.
  2550. Oct 27 20:21:44 localhost epgd: Downloaded 'PHOEN' for 2019-11-01 not changed, skipping.
  2551. Oct 27 20:21:44 localhost epgd: Downloaded 'PRO7' for 2019-11-01 with (89401) Bytes, changed since last load.
  2552. Oct 27 20:21:45 localhost epgd: Downloaded 'PRO7M' for 2019-11-01 with (64790) Bytes, changed since last load.
  2553. Oct 27 20:21:45 localhost epgd: Downloaded 'PULS4' for 2019-11-01 not changed, skipping.
  2554. Oct 27 20:21:45 localhost epgd: Downloaded 'RB-TV' for 2019-11-01 with (80290) Bytes, changed since last load.
  2555. Oct 27 20:21:45 localhost epgd: Downloaded 'RBB' for 2019-11-01 with (59913) Bytes, changed since last load.
  2556. Oct 27 20:21:46 localhost epgd: Downloaded 'RIC' for 2019-11-01 not changed, skipping.
  2557. Oct 27 20:21:46 localhost epgd: Downloaded 'RTL' for 2019-11-01 not changed, skipping.
  2558. Oct 27 20:21:46 localhost epgd: Downloaded 'RTL-N' for 2019-11-01 with (60002) Bytes, changed since last load.
  2559. Oct 27 20:21:46 localhost epgd: Downloaded 'RTL2' for 2019-11-01 with (28771) Bytes, changed since last load.
  2560. Oct 27 20:21:46 localhost epgd: Downloaded 'SAT1' for 2019-11-01 not changed, skipping.
  2561. Oct 27 20:21:46 localhost epgd: Downloaded 'SAT1G' for 2019-11-01 not changed, skipping.
  2562. Oct 27 20:21:47 localhost epgd: Downloaded 'SERVU' for 2019-11-01 with (75420) Bytes, changed since last load.
  2563. Oct 27 20:21:47 localhost epgd: Downloaded 'SIXX' for 2019-11-01 with (41854) Bytes, changed since last load.
  2564. Oct 27 20:21:47 localhost epgd: Downloaded 'SR' for 2019-11-01 not changed, skipping.
  2565. Oct 27 20:21:47 localhost epgd: Downloaded 'SUPER' for 2019-11-01 not changed, skipping.
  2566. Oct 27 20:21:47 localhost epgd: Downloaded 'SWRBW' for 2019-11-01 not changed, skipping.
  2567. Oct 27 20:21:47 localhost epgd: Downloaded 'TAG24' for 2019-11-01 with (51404) Bytes, changed since last load.
  2568. Oct 27 20:21:48 localhost epgd: Downloaded 'TELE5' for 2019-11-01 with (53234) Bytes, changed since last load.
  2569. Oct 27 20:21:48 localhost epgd: Downloaded 'TLC' for 2019-11-01 not changed, skipping.
  2570. Oct 27 20:21:48 localhost epgd: Downloaded 'TOGGO' for 2019-11-01 not changed, skipping.
  2571. Oct 27 20:21:48 localhost epgd: Downloaded 'VOX' for 2019-11-01 with (52510) Bytes, changed since last load.
  2572. Oct 27 20:21:48 localhost epgd: Downloaded 'WDR' for 2019-11-01 with (62883) Bytes, changed since last load.
  2573. Oct 27 20:21:49 localhost epgd: Downloaded 'WDWTV' for 2019-11-01 not changed, skipping.
  2574. Oct 27 20:21:50 localhost epgd: Downloaded 'ZDF' for 2019-11-01 with (95235) Bytes, changed since last load.
  2575. Oct 27 20:21:50 localhost epgd: Downloaded 'ZINFO' for 2019-11-01 with (95626) Bytes, changed since last load.
  2576. Oct 27 20:21:50 localhost epgd: Downloading images...
  2577. Oct 27 20:21:50 localhost epgd: Downloaded 0 images
  2578. Oct 27 20:21:50 localhost epgd: Updating 'tvm' day today+6 now
  2579. Oct 27 20:21:50 localhost epgd: Skipping day 6 for TVM plugin, since all days ar performed on day 0
  2580. Oct 27 20:21:50 localhost epgd: Updating 'tvsp' day today+6 now
  2581. Oct 27 20:21:50 localhost epgd: Downloaded '2NEO' for 2019-11-02 with (116640) Bytes, changed since last load.
  2582. Oct 27 20:21:51 localhost epgd: Downloaded '3SAT' for 2019-11-02 not changed, skipping.
  2583. Oct 27 20:21:51 localhost epgd: Downloaded 'ALPHA' for 2019-11-02 with (62832) Bytes, changed since last load.
  2584. Oct 27 20:21:51 localhost systemd[1]: Created slice User Slice of daniel.
  2585. Oct 27 20:21:51 localhost systemd[1]: Starting User Manager for UID 1000...
  2586. Oct 27 20:21:51 localhost systemd[1]: Started Session 3 of user daniel.
  2587. Oct 27 20:21:51 localhost systemd[4552]: Reached target Timers.
  2588. Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG network certificate management daemon.
  2589. Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent and passphrase cache (restricted).
  2590. Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent and passphrase cache.
  2591. Oct 27 20:21:51 localhost systemd[4552]: Starting D-Bus User Message Bus Socket.
  2592. Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent (ssh-agent emulation).
  2593. Oct 27 20:21:51 localhost systemd[4552]: Reached target Paths.
  2594. Oct 27 20:21:51 localhost systemd[4552]: Listening on GnuPG cryptographic agent and passphrase cache (access for web browsers).
  2595. Oct 27 20:21:51 localhost systemd[4552]: Listening on D-Bus User Message Bus Socket.
  2596. Oct 27 20:21:51 localhost systemd[4552]: Reached target Sockets.
  2597. Oct 27 20:21:51 localhost systemd[4552]: Reached target Basic System.
  2598. Oct 27 20:21:51 localhost systemd[4552]: Reached target Default.
  2599. Oct 27 20:21:51 localhost systemd[4552]: Startup finished in 50ms.
  2600. Oct 27 20:21:51 localhost epgd: Downloaded 'ANIXE' for 2019-11-02 not changed, skipping.
  2601. Oct 27 20:21:51 localhost systemd[1]: Started User Manager for UID 1000.
  2602. Oct 27 20:21:51 localhost epgd: Downloaded 'ARD' for 2019-11-02 with (94101) Bytes, changed since last load.
  2603. Oct 27 20:21:52 localhost epgd: Downloaded 'ARTE' for 2019-11-02 with (82291) Bytes, changed since last load.
  2604. Oct 27 20:21:53 localhost vdr: video: 23:37:52.723 +13 581 0/\ms 15+6+4 v-buf
  2605. Oct 27 20:21:55 localhost epgd: Downloaded 'ATV' for 2019-11-02 with (27544) Bytes, changed since last load.
  2606. Oct 27 20:21:55 localhost epgd: Downloaded 'ATV2' for 2019-11-02 with (38054) Bytes, changed since last load.
  2607. Oct 27 20:21:55 localhost epgd: Downloaded 'BBC' for 2019-11-02 not changed, skipping.
  2608. Oct 27 20:21:55 localhost epgd: Downloaded 'BR-S' for 2019-11-02 with (74074) Bytes, changed since last load.
  2609. Oct 27 20:21:55 localhost epgd: Downloaded 'CC' for 2019-11-02 with (96529) Bytes, changed since last load.
  2610. Oct 27 20:21:56 localhost epgd: Downloaded 'CNBC' for 2019-11-02 not changed, skipping.
  2611. Oct 27 20:21:56 localhost epgd: Downloaded 'DISNE' for 2019-11-02 with (71690) Bytes, changed since last load.
  2612. Oct 27 20:21:56 localhost epgd: Downloaded 'DMAX' for 2019-11-02 with (31316) Bytes, changed since last load.
  2613. Oct 27 20:21:56 localhost epgd: Downloaded 'EURON' for 2019-11-02 not changed, skipping.
  2614. Oct 27 20:21:57 localhost epgd: Downloaded 'FES' for 2019-11-02 with (74437) Bytes, changed since last load.
  2615. Oct 27 20:21:57 localhost epgd: Downloaded 'HR' for 2019-11-02 not changed, skipping.
  2616. Oct 27 20:21:57 localhost epgd: Downloaded 'K1' for 2019-11-02 with (58875) Bytes, changed since last load.
  2617. Oct 27 20:21:57 localhost epgd: Downloaded 'K1DOKU' for 2019-11-02 with (24276) Bytes, changed since last load.
  2618. Oct 27 20:21:57 localhost epgd: Downloaded 'KIKA' for 2019-11-02 not changed, skipping.
  2619. Oct 27 20:21:58 localhost epgd: Downloaded 'MDR' for 2019-11-02 with (72928) Bytes, changed since last load.
  2620. Oct 27 20:21:58 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-11-02]
  2621. Oct 27 20:21:58 localhost epgd: Downloaded 'N24' for 2019-11-02 failed, code: 0.
  2622. Oct 27 20:21:58 localhost epgd: Downloaded 'N24DOKU' for 2019-11-02 with (28472) Bytes, changed since last load.
  2623. Oct 27 20:21:58 localhost epgd: Downloaded 'NDR-HH' for 2019-11-02 with (72753) Bytes, changed since last load.
  2624. Oct 27 20:21:59 localhost epgd: Downloaded 'NICK' for 2019-11-02 with (57273) Bytes, changed since last load.
  2625. Oct 27 20:22:00 localhost epgd: Downloaded 'NTV' for 2019-11-02 with (45067) Bytes, changed since last load.
  2626. Oct 27 20:22:00 localhost epgd: Downloaded 'OE24TV' for 2019-11-02 not changed, skipping.
  2627. Oct 27 20:22:00 localhost epgd: Downloaded 'ORF1' for 2019-11-02 with (96723) Bytes, changed since last load.
  2628. Oct 27 20:22:00 localhost epgd: Downloaded 'ORF2' for 2019-11-02 with (51257) Bytes, changed since last load.
  2629. Oct 27 20:22:01 localhost epgd: Downloaded 'ORF3' for 2019-11-02 not changed, skipping.
  2630. Oct 27 20:22:01 localhost epgd: Downloaded 'ORFSP' for 2019-11-02 not changed, skipping.
  2631. Oct 27 20:22:01 localhost epgd: Downloaded 'PHOEN' for 2019-11-02 not changed, skipping.
  2632. Oct 27 20:22:01 localhost epgd: Downloaded 'PRO7' for 2019-11-02 with (86158) Bytes, changed since last load.
  2633. Oct 27 20:22:02 localhost epgd: Downloaded 'PRO7M' for 2019-11-02 not changed, skipping.
  2634. Oct 27 20:22:02 localhost epgd: Downloaded 'PULS4' for 2019-11-02 not changed, skipping.
  2635. Oct 27 20:22:02 localhost epgd: Downloaded 'RB-TV' for 2019-11-02 with (73547) Bytes, changed since last load.
  2636. Oct 27 20:22:04 localhost epgd: Downloaded 'RBB' for 2019-11-02 not changed, skipping.
  2637. Oct 27 20:22:04 localhost epgd: Downloaded 'RIC' for 2019-11-02 with (23785) Bytes, changed since last load.
  2638. Oct 27 20:22:04 localhost epgd: Downloaded 'RTL' for 2019-11-02 not changed, skipping.
  2639. Oct 27 20:22:04 localhost epgd: Downloaded 'RTL-N' for 2019-11-02 with (43728) Bytes, changed since last load.
  2640. Oct 27 20:22:05 localhost epgd: Downloaded 'RTL2' for 2019-11-02 with (34000) Bytes, changed since last load.
  2641. Oct 27 20:22:05 localhost epgd: Downloaded 'SAT1' for 2019-11-02 with (28948) Bytes, changed since last load.
  2642. Oct 27 20:22:06 localhost epgd: Downloaded 'SAT1G' for 2019-11-02 with (55028) Bytes, changed since last load.
  2643. Oct 27 20:22:07 localhost epgd: Downloaded 'SERVU' for 2019-11-02 with (71526) Bytes, changed since last load.
  2644. Oct 27 20:22:07 localhost epgd: Downloaded 'SIXX' for 2019-11-02 with (39540) Bytes, changed since last load.
  2645. Oct 27 20:22:07 localhost epgd: Downloaded 'SR' for 2019-11-02 not changed, skipping.
  2646. Oct 27 20:22:07 localhost epgd: Downloaded 'SUPER' for 2019-11-02 with (39736) Bytes, changed since last load.
  2647. Oct 27 20:22:07 localhost epgd: Downloaded 'SWRBW' for 2019-11-02 with (83608) Bytes, changed since last load.
  2648. Oct 27 20:22:08 localhost epgd: Downloaded 'TAG24' for 2019-11-02 not changed, skipping.
  2649. Oct 27 20:22:08 localhost epgd: Downloaded 'TELE5' for 2019-11-02 with (54400) Bytes, changed since last load.
  2650. Oct 27 20:22:08 localhost epgd: Downloaded 'TLC' for 2019-11-02 with (40306) Bytes, changed since last load.
  2651. Oct 27 20:22:09 localhost epgd: Downloaded 'TOGGO' for 2019-11-02 with (35407) Bytes, changed since last load.
  2652. Oct 27 20:22:09 localhost epgd: Downloaded 'VOX' for 2019-11-02 not changed, skipping.
  2653. Oct 27 20:22:09 localhost epgd: Downloaded 'WDR' for 2019-11-02 with (67517) Bytes, changed since last load.
  2654. Oct 27 20:22:10 localhost epgd: Downloaded 'WDWTV' for 2019-11-02 not changed, skipping.
  2655. Oct 27 20:22:10 localhost epgd: Downloaded 'ZDF' for 2019-11-02 with (125392) Bytes, changed since last load.
  2656. Oct 27 20:22:11 localhost epgd: Downloaded 'ZINFO' for 2019-11-02 not changed, skipping.
  2657. Oct 27 20:22:11 localhost epgd: Downloading images...
  2658. Oct 27 20:22:11 localhost epgd: Downloaded 1 images
  2659. Oct 27 20:22:11 localhost epgd: Updating 'tvm' day today+7 now
  2660. Oct 27 20:22:11 localhost epgd: Skipping day 7 for TVM plugin, since all days ar performed on day 0
  2661. Oct 27 20:22:11 localhost epgd: Updating 'tvsp' day today+7 now
  2662. Oct 27 20:22:11 localhost epgd: Downloaded '2NEO' for 2019-11-03 with (117873) Bytes, changed since last load.
  2663. Oct 27 20:22:11 localhost epgd: Downloaded '3SAT' for 2019-11-03 not changed, skipping.
  2664. Oct 27 20:22:11 localhost epgd: Downloaded 'ALPHA' for 2019-11-03 not changed, skipping.
  2665. Oct 27 20:22:11 localhost epgd: Downloaded 'ANIXE' for 2019-11-03 not changed, skipping.
  2666. Oct 27 20:22:11 localhost epgd: Downloaded 'ARD' for 2019-11-03 not changed, skipping.
  2667. Oct 27 20:22:11 localhost epgd: Downloaded 'ARTE' for 2019-11-03 with (87001) Bytes, changed since last load.
  2668. Oct 27 20:22:12 localhost epgd: Downloaded 'ATV' for 2019-11-03 not changed, skipping.
  2669. Oct 27 20:22:12 localhost epgd: Downloaded 'ATV2' for 2019-11-03 not changed, skipping.
  2670. Oct 27 20:22:12 localhost epgd: Downloaded 'BBC' for 2019-11-03 not changed, skipping.
  2671. Oct 27 20:22:12 localhost epgd: Downloaded 'BR-S' for 2019-11-03 with (76137) Bytes, changed since last load.
  2672. Oct 27 20:22:12 localhost epgd: Downloaded 'CC' for 2019-11-03 with (95532) Bytes, changed since last load.
  2673. Oct 27 20:22:13 localhost epgd: Downloaded 'CNBC' for 2019-11-03 not changed, skipping.
  2674. Oct 27 20:22:13 localhost epgd: Downloaded 'DISNE' for 2019-11-03 with (74558) Bytes, changed since last load.
  2675. Oct 27 20:22:13 localhost epgd: Downloaded 'DMAX' for 2019-11-03 with (29427) Bytes, changed since last load.
  2676. Oct 27 20:22:13 localhost epgd: Downloaded 'EURON' for 2019-11-03 not changed, skipping.
  2677. Oct 27 20:22:13 localhost epgd: Downloaded 'FES' for 2019-11-03 with (93609) Bytes, changed since last load.
  2678. Oct 27 20:22:14 localhost epgd: Downloaded 'HR' for 2019-11-03 with (93163) Bytes, changed since last load.
  2679. Oct 27 20:22:15 localhost epgd: Downloaded 'K1' for 2019-11-03 not changed, skipping.
  2680. Oct 27 20:22:15 localhost epgd: Downloaded 'K1DOKU' for 2019-11-03 not changed, skipping.
  2681. Oct 27 20:22:15 localhost epgd: Downloaded 'KIKA' for 2019-11-03 with (142604) Bytes, changed since last load.
  2682. Oct 27 20:22:16 localhost epgd: Downloaded 'MDR' for 2019-11-03 not changed, skipping.
  2683. Oct 27 20:22:16 localhost epgd: Error: Download failed; HTTP response code said error (22); http code was (403) [http://live.tvspielfilm.de/static/broadcast/list/N24/2019-11-03]
  2684. Oct 27 20:22:16 localhost epgd: Downloaded 'N24' for 2019-11-03 failed, code: 0.
  2685. Oct 27 20:22:17 localhost epgd: Downloaded 'N24DOKU' for 2019-11-03 with (33239) Bytes, changed since last load.
  2686. Oct 27 20:22:17 localhost epgd: Downloaded 'NDR-HH' for 2019-11-03 not changed, skipping.
  2687. Oct 27 20:22:17 localhost epgd: Downloaded 'NICK' for 2019-11-03 with (52274) Bytes, changed since last load.
  2688. Oct 27 20:22:17 localhost epgd: Downloaded 'NTV' for 2019-11-03 with (44859) Bytes, changed since last load.
  2689. Oct 27 20:22:18 localhost epgd: Downloaded 'OE24TV' for 2019-11-03 not changed, skipping.
  2690. Oct 27 20:22:18 localhost epgd: Downloaded 'ORF1' for 2019-11-03 with (66887) Bytes, changed since last load.
  2691. Oct 27 20:22:18 localhost epgd: Downloaded 'ORF2' for 2019-11-03 not changed, skipping.
  2692. Oct 27 20:22:18 localhost epgd: Downloaded 'ORF3' for 2019-11-03 not changed, skipping.
  2693. Oct 27 20:22:18 localhost epgd: Downloaded 'ORFSP' for 2019-11-03 not changed, skipping.
  2694. Oct 27 20:22:18 localhost epgd: Downloaded 'PHOEN' for 2019-11-03 not changed, skipping.
  2695. Oct 27 20:22:18 localhost epgd: Downloaded 'PRO7' for 2019-11-03 with (42638) Bytes, changed since last load.
  2696. Oct 27 20:22:18 localhost epgd: Downloaded 'PRO7M' for 2019-11-03 not changed, skipping.
  2697. Oct 27 20:22:18 localhost epgd: Downloaded 'PULS4' for 2019-11-03 not changed, skipping.
  2698. Oct 27 20:22:18 localhost epgd: Downloaded 'RB-TV' for 2019-11-03 not changed, skipping.
  2699. Oct 27 20:22:18 localhost epgd: Downloaded 'RBB' for 2019-11-03 not changed, skipping.
  2700. Oct 27 20:22:19 localhost epgd: Downloaded 'RIC' for 2019-11-03 not changed, skipping.
  2701. Oct 27 20:22:19 localhost epgd: Downloaded 'RTL' for 2019-11-03 not changed, skipping.
  2702. Oct 27 20:22:19 localhost epgd: Downloaded 'RTL-N' for 2019-11-03 with (44717) Bytes, changed since last load.
  2703. Oct 27 20:22:19 localhost epgd: Downloaded 'RTL2' for 2019-11-03 with (50905) Bytes, changed since last load.
  2704. Oct 27 20:22:20 localhost epgd: Downloaded 'SAT1' for 2019-11-03 with (29506) Bytes, changed since last load.
  2705. Oct 27 20:22:21 localhost epgd: Downloaded 'SAT1G' for 2019-11-03 with (69846) Bytes, changed since last load.
  2706. Oct 27 20:22:22 localhost epgd: Downloaded 'SERVU' for 2019-11-03 not changed, skipping.
  2707. Oct 27 20:22:22 localhost epgd: Downloaded 'SIXX' for 2019-11-03 with (47405) Bytes, changed since last load.
  2708. Oct 27 20:22:23 localhost epgd: Downloaded 'SR' for 2019-11-03 with (73676) Bytes, changed since last load.
  2709. Oct 27 20:22:23 localhost epgd: Downloaded 'SUPER' for 2019-11-03 with (36409) Bytes, changed since last load.
  2710. Oct 27 20:22:23 localhost epgd: Downloaded 'SWRBW' for 2019-11-03 with (74037) Bytes, changed since last load.
  2711. Oct 27 20:22:24 localhost epgd: Downloaded 'TAG24' for 2019-11-03 not changed, skipping.
  2712. Oct 27 20:22:24 localhost epgd: Downloaded 'TELE5' for 2019-11-03 with (43341) Bytes, changed since last load.
  2713. Oct 27 20:22:25 localhost epgd: Downloaded 'TLC' for 2019-11-03 not changed, skipping.
  2714. Oct 27 20:22:25 localhost epgd: Downloaded 'TOGGO' for 2019-11-03 not changed, skipping.
  2715. Oct 27 20:22:25 localhost epgd: Downloaded 'VOX' for 2019-11-03 not changed, skipping.
  2716. Oct 27 20:22:25 localhost epgd: Downloaded 'WDR' for 2019-11-03 with (72023) Bytes, changed since last load.
  2717. Oct 27 20:22:27 localhost epgd: Downloaded 'WDWTV' for 2019-11-03 not changed, skipping.
  2718. Oct 27 20:22:27 localhost epgd: Downloaded 'ZDF' for 2019-11-03 with (122000) Bytes, changed since last load.
  2719. Oct 27 20:22:27 localhost epgd: Downloaded 'ZINFO' for 2019-11-03 not changed, skipping.
  2720. Oct 27 20:22:27 localhost epgd: Downloading images...
  2721. Oct 27 20:22:27 localhost epgd: Downloaded 1 images
  2722. Oct 27 20:22:27 localhost epgd: EPG Update finished, loaded 236 files (15.411 MB), 260 non-updates skipped, 0 rejected due to format error.
  2723. Oct 27 20:22:27 localhost epgd: Calling sd_notify(STATUS=Ready)
  2724. Oct 27 20:22:27 localhost epgd: Starting 'update' episode download ...
  2725. Oct 27 20:22:28 localhost epgd: Got 'Setting encoding to utf8'
  2726. Oct 27 20:22:28 localhost epgd: Requesting episode changes of last 753 minutes
  2727. Oct 27 20:22:28 localhost epgd: Received 1 episode files
  2728. Oct 27 20:22:29 localhost epgd: Starting episode lookup ...
  2729. Oct 27 20:22:29 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [ROGERDERGERADESEINABSCHLUSSZEUGNISIMARCHÄOLOGIESTUDIUMERHALTENHATBEKOMMTVONDERFAMILIEEINEHARTEABFUHRNIEMANDWÜRDIGTSEINEERFOLGEDENNSIESEIENALLENURERLOGENUNDERSCHUMMELTFRANCINEBERUHIGTROGERUNDUNTERSTÜ]
  2730. Oct 27 20:22:29 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [ROGERDERGERADESEINABSCHLUSSZEUGNISIMARCHÄOLOGIESTUDIUMERHALTENHATBEKOMMTVONDERFAMILIEEINEHARTEABFUHRNIEMANDWÜRDIGTSEINEERFOLGEDENNSIESEIENALLENURERLOGENUNDERSCHUMMELTFRANCINEBERUHIGTROGERUNDUNTERSTÜ]
  2731. Oct 27 20:22:32 localhost vdr: [1799] [softhddev]SetVolumeDevice: 60
  2732. Oct 27 20:22:32 localhost vdr: [1799] [softhddev]CreateOsd: left 384, top 918, level 0, using OpenGL OSD support
  2733. Oct 27 20:22:32 localhost vdr: [1799] [softhddev]cOglOsd osdLeft 384 osdTop 918 screenWidth 1920 screenHeight 1080
  2734. Oct 27 20:22:32 localhost vdr: [5045] animator thread thread started (pid=1799, tid=5045, prio=high)
  2735. Oct 27 20:22:32 localhost vdr: [1799] [softhddev]SetVolumeDevice: 65
  2736. Oct 27 20:22:32 localhost vdr: [1799] [softhddev]SetVolumeDevice: 70
  2737. Oct 27 20:22:33 localhost vdr: [5045] animator thread thread ended (pid=1799, tid=5045)
  2738. Oct 27 20:22:34 localhost vdr: [1799] [softhddev]SetVolumeDevice: 65
  2739. Oct 27 20:22:34 localhost vdr: [1799] [softhddev]CreateOsd: left 384, top 918, level 0, using OpenGL OSD support
  2740. Oct 27 20:22:34 localhost vdr: [1799] [softhddev]cOglOsd osdLeft 384 osdTop 918 screenWidth 1920 screenHeight 1080
  2741. Oct 27 20:22:34 localhost vdr: [5181] animator thread thread started (pid=1799, tid=5181, prio=high)
  2742. Oct 27 20:22:35 localhost vdr: [5181] animator thread thread ended (pid=1799, tid=5181)
  2743. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIEUNDJOYGEHENMITSIMONAUNDSTEPHENESSENUNDKURZBEVORDERNACHTISCHKOMMTVERABSCHIEDENSIESICHSCHNELLDASIEMORGENSFRÃœHARBEITENMÃœSSENZUMDRITTENMALBLEIBENDAMITSTEPHENUNDSIMONAAUFEINERRESTAURANTRECHNUNGSITZEN]
  2744. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIEUNDJOYGEHENMITSIMONAUNDSTEPHENESSENUNDKURZBEVORDERNACHTISCHKOMMTVERABSCHIEDENSIESICHSCHNELLDASIEMORGENSFRÃœHARBEITENMÃœSSENZUMDRITTENMALBLEIBENDAMITSTEPHENUNDSIMONAAUFEINERRESTAURANTRECHNUNGSITZEN]
  2745. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]
  2746. Oct 27 20:22:36 localhost epgd: message repeated 3 times: [ Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]]
  2747. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIEUNDJOYGEHENMITSIMONAUNDSTEPHENESSENUNDKURZBEVORDERNACHTISCHKOMMTVERABSCHIEDENSIESICHSCHNELLDASIEMORGENSFRÃœHARBEITENMÃœSSENZUMDRITTENMALBLEIBENDAMITSTEPHENUNDSIMONAAUFEINERRESTAURANTRECHNUNGSITZEN]
  2748. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]
  2749. Oct 27 20:22:36 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [EDDIESGEHALTSERHÖHUNGISTINGEFAHRFÜRLEHRERGILTJETZTDASLEISTUNGSPRINZIPSEINEKLASSEMUSSEINENBESTIMMTENNOTENDURCHSCHNITTERREICHENANSONSTENFÄLLTDIEERHÖHUNGFÜRIHNAUSDUMMERWEISESITZTFELDMANINSEINERKLASSE]
  2750. Oct 27 20:22:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2751. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [CARTMANWIRDSOFORTSTUTZIGALSEINMUSLIMISCHERJUNGENACHSOUTHPARKZIEHTUNDSOBEGINNTEREINEAUFWÄNDIGERECHERCHEDIEZUMERGEBNISHATDASOFFENBARTATSÄCHLICHEINANSCHLAGAUFHILLARYCLINTONWÄHRENDIHRESBESUCHSINSOUTHPARK]
  2752. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [CARTMANWIRDSOFORTSTUTZIGALSEINMUSLIMISCHERJUNGENACHSOUTHPARKZIEHTUNDSOBEGINNTEREINEAUFWÄNDIGERECHERCHEDIEZUMERGEBNISHATDASOFFENBARTATSÄCHLICHEINANSCHLAGAUFHILLARYCLINTONWÄHRENDIHRESBESUCHSINSOUTHPARK]
  2753. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
  2754. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
  2755. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [IMMERWENNMSGARRISONEINENPARTNERVERLORENHATISTSIESOFRUSTRIERTDASSSIEIHREWUTANDENKINDERNIHRERKLASSEAUSLÄSSTDIESERZUSTANDÄNDERTSICHGRUNDLEGENDALSMSGARRISONINEINERLESBENBARIHREGEFÜHLEFÜRSEIGENEGESCHLEC]
  2756. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [IMMERWENNMSGARRISONEINENPARTNERVERLORENHATISTSIESOFRUSTRIERTDASSSIEIHREWUTANDENKINDERNIHRERKLASSEAUSLÄSSTDIESERZUSTANDÄNDERTSICHGRUNDLEGENDALSMSGARRISONINEINERLESBENBARIHREGEFÜHLEFÜRSEIGENEGESCHLEC]
  2757. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [DIESTADTWIRDVONEINERHARLEYMOTORRADGANGHEIMGESUCHTDIEMITIHRENMASCHINENSTÄNDIGLAUTDURCHDIESTRAßENCRUISENCARTMANUNDDIEJUNGSHALTENDIESESPUBERTÄREPROLOTREIBENFÜRHÖCHSTSCHWUCHTELHAFTUNDWOLLENDIEBIKERAUSDERST]
  2758. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [DIESTADTWIRDVONEINERHARLEYMOTORRADGANGHEIMGESUCHTDIEMITIHRENMASCHINENSTÄNDIGLAUTDURCHDIESTRAßENCRUISENCARTMANUNDDIEJUNGSHALTENDIESESPUBERTÄREPROLOTREIBENFÜRHÖCHSTSCHWUCHTELHAFTUNDWOLLENDIEBIKERAUSDERST]
  2759. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
  2760. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
  2761. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [DIEJUNGSVONSOUTHPARKSINDDEMNEUESTENFUNTRENDVERFALLENCHINPOKOMONEINCARTOONAUSJAPANDIEERWACHSENENMACHENSICHSEHRSPÄTERSTGEDANKENÜBERDIEVERÄNDERUNGENIMVERHALTENIHRERKINDERDIENUNALLEPLÖTZLICHJAPANISCHSP]
  2762. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 201) [DIEJUNGSVONSOUTHPARKSINDDEMNEUESTENFUNTRENDVERFALLENCHINPOKOMONEINCARTOONAUSJAPANDIEERWACHSENENMACHENSICHSEHRSPÄTERSTGEDANKENÜBERDIEVERÄNDERUNGENIMVERHALTENIHRERKINDERDIENUNALLEPLÖTZLICHJAPANISCHSP]
  2763. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
  2764. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATDIEJUNGSBESCHLIEßENDIESEZUNÄCHSTZUT]
  2765. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
  2766. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 207) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERMEHR]
  2767. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [SHELLYSOLLAUFCARTMANAUFPASSENWÄHRENDSEINEMUTTERAUFEINERPARTYISTWÄHRENDCARTMANUNDSHELLYLOSZIEHENUMSHELLYSEXFREUNDEINSAUSZUWISCHENFEIERTCARTMANSROLLIGEMIEZEINDERZWISCHENZEITEINEWILDEKATZENORGIEINDEMLEER]
  2768. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [SHELLYSOLLAUFCARTMANAUFPASSENWÄHRENDSEINEMUTTERAUFEINERPARTYISTWÄHRENDCARTMANUNDSHELLYLOSZIEHENUMSHELLYSEXFREUNDEINSAUSZUWISCHENFEIERTCARTMANSROLLIGEMIEZEINDERZWISCHENZEITEINEWILDEKATZENORGIEINDEMLEER]
  2769. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [AUFDERMETEORITENSCHAUERPARTYMUSSSTANMITDEN3GRÖßTENSTREBERNDERSCHULEIMKELLERSPIELENWÄHRENDSEINEELTERNOBENFEIERNSTANSVATERRANDYUNDGERALDFINDENSICHNACKTIMWHIRLPOOLWIEDERUNDBESCHLIEßENIHRENSEXPHANTASIEN]
  2770. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [AUFDERMETEORITENSCHAUERPARTYMUSSSTANMITDEN3GRÖßTENSTREBERNDERSCHULEIMKELLERSPIELENWÄHRENDSEINEELTERNOBENFEIERNSTANSVATERRANDYUNDGERALDFINDENSICHNACKTIMWHIRLPOOLWIEDERUNDBESCHLIEßENIHRENSEXPHANTASIEN]
  2771. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 202) [NACHDEMDIEPANFLÖTENSPIELERVONDENSTRAßENGEHOLTWURDENBRICHTÜBERALLINDENSTÄDTENDASCHAOSAUSRIESIGEMEERSCHWEINCHENATTACKIERENDIEBEWOHNERDIEJUNGSWURDENVONDERNATIONALENSICHERHEITNACHPERUGEBRACHTUMDENGRUNDD]
  2772. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 205) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATALSOBESCHLIEßENDIEJUNGSDIESEZUNÄCH]
  2773. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 206) [MRGARRISONLÄDTDENSEXUELLENBELÄSTIGUNGSPANDAINDENUNTERRICHTEINDAMITDIESCHÜLERALLESÜBERGESETZEZURVERHINDERUNGVONSEXUELLERBELÄSTIGUNGERFAHRENWEGENEINESZWEIDEUTIGENKRAFTAUSDRUCKSVERKLAGTCARTMANSTANDANNAUFS]
  2774. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 205) [ALSABWECHSLUNGZUMÖDENWERKUNTERRICHTARRANGIERENDIEJUNGSEINENBOXKAMPFZWISCHENTWEEKUNDCRAIGLEIDERZEIGTSICHDAßWEDERDEREINENOCHDERANDEREKÄMPFERGROßEERFAHRUNGIMPRÜGELNHATALSOBESCHLIEßENDIEJUNGSDIESEZUNÄCH]
  2775. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 204) [DIESTADTWIRDVONEINERHARLEYMOTORRADGANGHEIMGESUCHTDIEMITIHRENMASCHINENSTÄNDIGLAUTDURCHDIESTRAßENCRUISENCARTMANUNDDIEJUNGSHALTENDIESESPUBERTÄREPROLOTREIBENFÜRHÖCHSTSCHWUCHTELHAFTUNDWOLLENDIEBIKERAUSDER]
  2776. Oct 27 20:22:45 localhost epgd: Warning, size of 200 for 'COMPPARTNAME' exeeded (needed 205) [DIEJUNGSENTDECKENBEIIHREMCAMPINGAUSFLUGEINENLEBENDENPRÄHISTORISCHENJAKOVASAURUSEINNERVTÖTENDESWESENDASMANFÜRAUSGESTORBENHIELTKURZEZEITSPÄTERTAUCHTAUCHNOCHDASPASSENDEMÄNNCHENAUFUNDDIEBEIDENSAURIERVERME]
  2777. Oct 27 20:22:50 localhost epgd: Lookup done for 2292 series, matched 19304 parts by compare and 807 parts by lv in 21 seconds; Updated 396
  2778. Oct 27 20:22:50 localhost epgd: Calling 'mergeepg'
  2779. Oct 27 20:22:53 localhost vdr: video: 23:38:52.723 +13 581 0/\ms 15+6+4 v-buf
  2780. Oct 27 20:23:37 localhost vdr: [1932] changing caids of channel 6294 (UHD1 by ASTRA / HD+) from 0 to 1830,1843,1860,186A,186D,9C4,98C,98D,1842,4B64
  2781. Oct 27 20:23:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2782. Oct 27 20:23:53 localhost vdr: video: 23:39:52.723 +13 581 0/\ms 12+6+4 v-buf
  2783. Oct 27 20:24:42 localhost vdr: scraper2vdr: epgd busy, trying again in 60 seconds ...
  2784. Oct 27 20:24:53 localhost vdr: video: 23:40:52.723 +13 645 0/\ms 15+6+4 v-buf
  2785. Oct 27 20:25:01 localhost vdr: [1932] changing pids of channel 8112 (Sky Cinema Action HD) from 767+767=27:0;771=deu@106,772=eng@106:0:0 to 767+767=27:0;771=deu@106:0:0
  2786. Oct 27 20:25:02 localhost vdr: [1932] changing portal name of channel 8146 (Sky Sport 2) from '' to 'Formel 1'
  2787. Oct 27 20:25:02 localhost vdr: [1932] changing name of channel 8196 from '18:00 Formel1 PK,;' to 'F1 Race Control,;'
  2788. Oct 27 20:25:02 localhost vdr: [1932] linking channel 8146 (Sky Sport 2) from none to 8196
Add Comment
Please, Sign In to add comment
Public Pastes
We use cookies for various purposes including analytics. By continuing to use Pastebin, you agree to our use of cookies as described in the Cookies Policy.  OK, I Understand
Not a member of Pastebin yet?
Sign Up, it unlocks many cool features!