Guest User

Adenylate cyclase/CAA

a guest
May 9th, 2019
242
Never
Not a member of Pastebin yet? Sign Up, it unlocks many cool features!
  1. ; Alignment contrustructed with the active site alignment
  2. ; from PMID 18620542 forced. The protein was aligned in two
  3. ; parts by ClustalW (UniProtKB defaults).
  4. >P00936
  5. MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKG
  6. ICLYTPDETQRHYLNELELYRGMSVQDPPKGELPITGV--YTMGSTS-SVGQSCSSDLDIWVCHQ
  7. SWLDSEERQLLQRKCSLLENWAASLGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHILL
  8. LDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLS------
  9. ----SLSAEEYFGAS-------------LWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPR
  10. LLAKDIKQRLHDGEIVSFGLDPYCMMLERVTEYLTAIEDFTRLDLVRRCFYLKVCEKLSR
  11. ERACVGWRRA---------VLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNELLDAM
  12. MQSYRNLIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLT
  13. FIYVPPGR-----ANRSGWYLYNRAPNIESIISHQPLEYNRYLNKLVAWAWFNGLLTSRT
  14. RLY---IKGNGIVDLPKLQEMVADVSHHFPLRL
  15. >1R89:A|PDBID|CHAIN|SEQUENCE
  16. -----------------MK---------------------------------VEEILEKA
  17. LELVIPDEEE--------VRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFP
  18. -----EE---------FSKEELRERGLEIGKAVLDSYEIRYAEHPYVHG-----------
  19. -----------VVKGVEVDVVPCYKLKEPKNIKSAV--DRTPFHHKWLEGRIKGKENEVR
  20. LLKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSF-------LE-TVKNARRWTRRTVI
  21. DVA---KGEVRKGEE-FFVVDPV-------DEKRNVA---ANLSLDNLARFVHLCREFME
  22. A-PSLGFFKPKHPLEIEPERLRKIVEERGTAVFAV---------KFRKPDIVDDNLYPQL
  23. ERASRKIFEFLERENFMPLRSAF--KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNV
  24. KKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEG-----VRSY--ASTHWHTLGKNVGESI
  25. REYFEIISGEKLFKEPVTAELCEMMG----VKD
RAW Paste Data

Adblocker detected! Please consider disabling it...

We've detected AdBlock Plus or some other adblocking software preventing Pastebin.com from fully loading.

We don't have any obnoxious sound, or popup ads, we actively block these annoying types of ads!

Please add Pastebin.com to your ad blocker whitelist or disable your adblocking software.

×