SHARE
TWEET

Adenylate cyclase/CAA

a guest May 9th, 2019 106 Never
Not a member of Pastebin yet? Sign Up, it unlocks many cool features!
  1. ; Alignment contrustructed with the active site alignment
  2. ; from PMID 18620542 forced. The protein was aligned in two
  3. ; parts by ClustalW (UniProtKB defaults).
  4. >P00936
  5. MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKG
  6. ICLYTPDETQRHYLNELELYRGMSVQDPPKGELPITGV--YTMGSTS-SVGQSCSSDLDIWVCHQ
  7. SWLDSEERQLLQRKCSLLENWAASLGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHILL
  8. LDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLS------
  9. ----SLSAEEYFGAS-------------LWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPR
  10. LLAKDIKQRLHDGEIVSFGLDPYCMMLERVTEYLTAIEDFTRLDLVRRCFYLKVCEKLSR
  11. ERACVGWRRA---------VLSQLVSEWGWDEARLAMLDNRANWKIDQVREAHNELLDAM
  12. MQSYRNLIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLT
  13. FIYVPPGR-----ANRSGWYLYNRAPNIESIISHQPLEYNRYLNKLVAWAWFNGLLTSRT
  14. RLY---IKGNGIVDLPKLQEMVADVSHHFPLRL
  15. >1R89:A|PDBID|CHAIN|SEQUENCE
  16. -----------------MK---------------------------------VEEILEKA
  17. LELVIPDEEE--------VRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFP
  18. -----EE---------FSKEELRERGLEIGKAVLDSYEIRYAEHPYVHG-----------
  19. -----------VVKGVEVDVVPCYKLKEPKNIKSAV--DRTPFHHKWLEGRIKGKENEVR
  20. LLKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSF-------LE-TVKNARRWTRRTVI
  21. DVA---KGEVRKGEE-FFVVDPV-------DEKRNVA---ANLSLDNLARFVHLCREFME
  22. A-PSLGFFKPKHPLEIEPERLRKIVEERGTAVFAV---------KFRKPDIVDDNLYPQL
  23. ERASRKIFEFLERENFMPLRSAF--KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNV
  24. KKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEG-----VRSY--ASTHWHTLGKNVGESI
  25. REYFEIISGEKLFKEPVTAELCEMMG----VKD
RAW Paste Data
We use cookies for various purposes including analytics. By continuing to use Pastebin, you agree to our use of cookies as described in the Cookies Policy. OK, I Understand
Not a member of Pastebin yet?
Sign Up, it unlocks many cool features!
 
Top