Guest User

fasta alignment

a guest
May 25th, 2010
435
Never
Not a member of Pastebin yet? Sign Up, it unlocks many cool features!
  1. sp|P00374|DYR_HUMAN       -----VGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKK 55
  2. sp|P00375|DYR_MOUSE       -----VRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRK 55
  3. sp|P00378|DYR_CHICK       -----VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKK 55
  4. sp|P07807|DYR_YEAST       MAGGKIPIVGIVACLQPEMGIGFRGGLPWR-LPSEMKYFRQVTSLTKDPNKKNALIMGRK 59
  5. sp|P11731|DYR5_ECOLI      ------MKVSLMAAKAKNGVIGCGPHIPWS-AKGEQLLFKALTYN-------QWLLVGRK 46
  6.                                   :. :..   :  **    :**    .*   *: :*         : :::*:*
  7.  
  8. sp|P00374|DYR_HUMAN       TWFSIPEKNRPLKGRINLVLSRELKE----PPQGAHFLSRSLDDALKLTEQPELANKVDM 111
  9. sp|P00375|DYR_MOUSE       TWFSIPEKNRPLKDRINIVLSRELKE----PPRGAHFLAKSLDDALRLIEQPELASKVDM 111
  10. sp|P00378|DYR_CHICK       TWFSIPEKNRPLKDRINIVLSRELKE----APKGAHYLSKSLDDALALLDSPELKSKVDM 111
  11. sp|P07807|DYR_YEAST       TWESIPPKFRPLPNRMNVIISRSFKDDFVHDKERSIVQSNSLANAIMNLES-NFKEHLER 118
  12. sp|P11731|DYR5_ECOLI      TFESMG----ALPNRKYAVVTRSAWT----ADNDNVIVFPSIEEAMY-----GLAELTDH 93
  13.                           *: *:     .* .*   :::*.         .       *: :*:       : .  :
  14.  
  15. sp|P00374|DYR_HUMAN       VWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFES------------DTFFPEIDLEKYKLL 159
  16. sp|P00375|DYR_MOUSE       VWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFES------------DTFFPEIDLGKYKLL 159
  17. sp|P00378|DYR_CHICK       VWIVGGTAVYKAAMEKPINHRLFVTRILHEFES------------DTFFPEIDYKDFKLL 159
  18. sp|P07807|DYR_YEAST       IYVIGGGEVYSQIFSITDHWLITKINPLDKNATPAMDTFLDAKKLEEVFSEQDPAQLKEF 178
  19. sp|P11731|DYR5_ECOLI      VIVSGGGEIYRETLPMASTLHISTIDIEPEGDV--------------FFPNIP------- 132
  20.                           : : **  :*   :  .    :       .                 .*.:        
  21.  
  22. sp|P00374|DYR_HUMAN       P----EYPGVLSDVQ---EEKGIKYKFEVYEKND--- 186
  23. sp|P00375|DYR_MOUSE       P----EYPGVLSEVQ---EEKGIKYKFEVYEKKD--- 186
  24. sp|P00378|DYR_CHICK       T----EYPGVPADIQ---EEDGIQYKFEVYQKSVLAQ 189
  25. sp|P07807|DYR_YEAST       LPPKVELPETDCDQRYSLEEKGYCFEFTLYNRK---- 211
  26. sp|P11731|DYR5_ECOLI      -----NTFEVVFEQH---FSSNINYCYQIWQKG---- 157
  27.                                :   .  : :    ...  : : ::::
RAW Paste Data

Adblocker detected! Please consider disabling it...

We've detected AdBlock Plus or some other adblocking software preventing Pastebin.com from fully loading.

We don't have any obnoxious sound, or popup ads, we actively block these annoying types of ads!

Please add Pastebin.com to your ad blocker whitelist or disable your adblocking software.

×