Not a member of Pastebin yet?
Sign Up,
it unlocks many cool features!
- ==> STRAIN_ID.tbl <==
- >Feature scaffold_0001
- 396 1028 CDS
- inference ab initio prediction:Prodigal:2.6
- locus_tag STRAIN_ID_00001
- product hypothetical protein
- 396 1028 gene
- locus_tag STRAIN_ID_00001
- 1229 1603 CDS
- inference ab initio prediction:Prodigal:2.6
- locus_tag STRAIN_ID_00002
- product hypothetical protein
- 1229 1603 gene
- locus_tag STRAIN_ID_00002
- 1605 2255 CDS
- inference ab initio prediction:Prodigal:2.6
- inference similar to AA sequence:UniProtKB:P0A0N1
- locus_tag STRAIN_ID_00003
- product DegV domain-containing protein
- 1605 2255 gene
- locus_tag STRAIN_ID_00003
- 2507 3274 CDS
- EC_number 1.17.1.8
- gene dapB
- inference ab initio prediction:Prodigal:2.6
- inference similar to AA sequence:UniProtKB:P63895
- locus_tag STRAIN_ID_00004
- product 4-hydroxy-tetrahydrodipicolinate reductase
- 2507 3274 gene
- gene dapB
- locus_tag STRAIN_ID_00004
- ==> STRAIN_ID.tsv <==
- locus_tag ftype gene EC_number product
- STRAIN_ID_00001 CDS hypothetical protein
- STRAIN_ID_00001 gene
- STRAIN_ID_00002 CDS hypothetical protein
- STRAIN_ID_00002 gene
- STRAIN_ID_00003 CDS DegV domain-containing protein
- STRAIN_ID_00003 gene
- STRAIN_ID_00004 CDS dapB 1.17.1.8 4-hydroxy-tetrahydrodipicolinate reductase
- STRAIN_ID_00004 gene dapB
- STRAIN_ID_00005 CDS cca 2.7.7.72 CCA-adding enzyme
- STRAIN_ID_00005 gene cca
- STRAIN_ID_00006 CDS ettA Energy-dependent translational throttle protein EttA
- STRAIN_ID_00006 gene ettA
- STRAIN_ID_00007 CDS hypothetical protein
- STRAIN_ID_00007 gene
- STRAIN_ID_00008 CDS Bifunctional NMN adenylyltransferase/Nudix hydrolase
- STRAIN_ID_00008 gene
- STRAIN_ID_00009 CDS nadR Trifunctional NAD biosynthesis/regulator protein NadR
- STRAIN_ID_00009 gene nadR
- STRAIN_ID_00010 CDS gdh 1.4.1.4 NADP-specific glutamate dehydrogenase
- STRAIN_ID_00010 gene gdh
- STRAIN_ID_00011 CDS def_1 3.5.1.88 Peptide deformylase
- ==> STRAIN_ID.gbk <==
- LOCUS scaffold_0001 176405 bp DNA linear 13-SEP-2017
- DEFINITION Genus species strain STRAIN_ID.
- ACCESSION
- VERSION
- KEYWORDS .
- SOURCE Genus species
- ORGANISM Genus species
- Unclassified.
- COMMENT Annotated using prokka 1.12 from
- https://github.com/tseemann/prokka.
- FEATURES Location/Qualifiers
- source 1..176405
- /organism="Genus species"
- /mol_type="genomic DNA"
- /strain="STRAIN_ID"
- gene 396..1028
- /locus_tag="STRAIN_ID_00001"
- CDS 396..1028
- /locus_tag="STRAIN_ID_00001"
- /inference="ab initio prediction:Prodigal:2.6"
- /codon_start=1
- /transl_table=11
- /product="hypothetical protein"
- /translation="MPDVALLEGRYCSVEHLTVAEHYEDILDFYFTNQILSDWTYMYA
- DPFESEEAVRQCLEDYEQSQNPYFFAIRDKASGKVLGTFSLMAITPKNRSVEMGRVIL
- APALQKTRAATEAQYLLMKYVFEDLNYRRYEWKCDSLNRPSANAAIRLGFTYEGRFRN
- HAIYKGRSRDTDWFSIIDSEWPVLKKRFENWLSPENFDEQGQQKRSLRDC"
- gene 1229..1603
- /locus_tag="STRAIN_ID_00002"
- CDS 1229..1603
- ==> STRAIN_ID.gff <==
- ##gff-version 3
- ##sequence-region scaffold_0001 1 176405
- ##sequence-region scaffold_0002 1 108000
- ##sequence-region scaffold_0003 1 106562
- ##sequence-region scaffold_0004 1 106045
- ##sequence-region scaffold_0005 1 101997
- ##sequence-region scaffold_0006 1 100568
- ##(...)
- scaffold_0001 Prodigal:2.6 CDS 396 1028 . + 0 ID=STRAIN_ID_00001;Parent=STRAIN_ID_00001_gene;inference=ab initio prediction:Prodigal:2.6;locus_tag=STRAIN_ID_00001;product=hypothetical protein
- scaffold_0001 prokka gene 396 1028 . + . ID=STRAIN_ID_00001_gene;locus_tag=STRAIN_ID_00001
- scaffold_0001 Prodigal:2.6 CDS 1229 1603 . + 0 ID=STRAIN_ID_00002;Parent=STRAIN_ID_00002_gene;inference=ab initio prediction:Prodigal:2.6;locus_tag=STRAIN_ID_00002;product=hypothetical protein
- scaffold_0001 prokka gene 1229 1603 . + . ID=STRAIN_ID_00002_gene;locus_tag=STRAIN_ID_00002
- scaffold_0001 Prodigal:2.6 CDS 1605 2255 . + 0 ID=STRAIN_ID_00003;Parent=STRAIN_ID_00003_gene;inference=ab initio prediction:Prodigal:2.6,similar to AA sequence:UniProtKB:P0A0N1;locus_tag=STRAIN_ID_00003;product=DegV domain-containing protein
- scaffold_0001 prokka gene 1605 2255 . + . ID=STRAIN_ID_00003_gene;locus_tag=STRAIN_ID_00003
- scaffold_0001 Prodigal:2.6 CDS 2507 3274 . + 0 ID=STRAIN_ID_00004;Parent=STRAIN_ID_00004_gene;eC_number=1.17.1.8;Name=dapB;gene=dapB;inference=ab initio prediction:Prodigal:2.6,similar to AA sequence:UniProtKB:P63895;locus_tag=STRAIN_ID_00004;product=4-hydroxy-tetrahydrodipicolinate reductase
- scaffold_0001 prokka gene 2507 3274 . + . ID=STRAIN_ID_00004_gene;Name=dapB;gene=dapB;locus_tag=STRAIN_ID_00004
- scaffold_0001 Prodigal:2.6 CDS 3271 4479 . + 0 ID=STRAIN_ID_00005;Parent=STRAIN_ID_00005_gene;eC_number=2.7.7.72;Name=cca;gene=cca;inference=ab initio prediction:Prodigal:2.6,similar to AA sequence:UniProtKB:Q7SIB1;locus_tag=STRAIN_ID_00005;product=CCA-adding enzyme
- scaffold_0001 prokka gene 3271 4479 . + . ID=STRAIN_ID_00005_gene;Name=cca;gene=cca;locus_tag=STRAIN_ID_00005
- scaffold_0001 Prodigal:2.6 CDS 4557 6437 . + 0 ID=STRAIN_ID_00006;Parent=STRAIN_ID_00006_gene;Name=ettA;gene=ettA;inference=ab initio prediction:Prodigal:2.6,similar to AA sequence:UniProtKB:P0A9W3;locus_tag=STRAIN_ID_00006;product=Energy-dependent translational throttle protein EttA
- scaffold_0001 prokka gene 4557 6437 . + . ID=STRAIN_ID_00006_gene;Name=ettA;gene=ettA;locus_tag=STRAIN_ID_00006
Advertisement
Add Comment
Please, Sign In to add comment
