Not a member of Pastebin yet?
Sign Up,
it unlocks many cool features!
- <drug type="biotech" created="2005-06-13" updated="2013-06-19">
- <drugbank-id primary="true">DB00026</drugbank-id>
- <drugbank-id>BIOD00060</drugbank-id>
- <drugbank-id>BTD00060</drugbank-id>
- <name>Anakinra</name>
- <description>Anakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between anakinra and the native human IL-1Ra is that anakinra has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues. FDA approved on November 14, 2001. </description>
- <cas-number>143090-92-0</cas-number>
- <groups>
- <group>approved</group>
- </groups>
- <general-references># Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/11752352
- # Lequerré T, Quartier P, Rosellini D, Alaoui F, De Bandt M, Mejjad O, Kone-Paut I, Michel M, Dernis E, Khellaf M, Limal N, Job-Deslandre C, Fautrel B, Le Loët X, Sibilia J; Société Francophone pour la Rhumatologie et les Maladies Inflammatoires en Pédiatrie (SOFREMIP); Club Rhumatismes et Inflammation (CRI): Interleukin-1 receptor antagonist (anakinra) treatment in patients with systemic-onset juvenile idiopathic arthritis or adult onset Still disease: preliminary experience in France. Ann Rheum Dis. 2008 Mar;67(3):281-2.
- "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17947302
- # FDA label </general-references>
- <synthesis-reference/>
- <indication>For the treatment of adult rheumatoid arthritis and treatment of Neonatal-Onset Multisystem Inflammatory Disease (NOMID). </indication>
- <pharmacodynamics>Used to treat rheumatoid arthritis, Anakinra blocks the biologic activity of IL-1 by competitively inhibiting IL-1 binding to the interleukin-1 type I receptor (IL-1RI), which is expressed in a wide variety of tissues and organs. IL-1 production is induced in response to inflammatory stimuli and mediates various physiologic responses including inflammatory and immunological responses. Patients with rheumatoid arthritis have elevated levels of IL-1. The levels of the naturally occurring IL-1Ra in synovium and synovial fluid from rheumatoid arthritis (RA) patients are not sufficient to compete with the elevated amount of locally produced IL-1. Increasing the levels of IL-1Ra by artificial means reduces the negative effects (cartilage degradation, bone resorption) of IL-1.</pharmacodynamics>
- <mechanism-of-action>Anakinra binds competitively to the Interleukin-1 type I receptor (IL-1RI), thereby inhibiting the action of elevated levels IL-1 which normally can lead to cartilage degradation and bone resorption.</mechanism-of-action>
- <toxicity>Most common adverse reactions (incidence ≥ 5%) are injection site reaction, worsening of rheumatoid arthritis, upper respiratory tract infection, headache, nausea, diarrhea, sinusitis, arthralgia, flu like-symptoms, and abdominal pain when anakinra is used in RA patients. In NOMID patients, the most common AEs during the first 6 months of treatment (incidence >10%) are injection site reaction, headache, vomiting, arthralgia, pyrexia, and nasopharyngitis. </toxicity>
- <metabolism/>
- <absorption>When a 70 mg subcutaneous bolus injection is given to healthy subjects, the absolute bioavailability is 95%. Accumulation does not occur following daily subcutaneous doses.
- Tmax, SubQ, 1-2 mg/kg, healthy subjects = 3-7 hours;
- Cmax, SubQ, 3 mg/kg once daily, NOMID patients = 3628 ng/mL.
- </absorption>
- <half-life>Healthy subjects = 4 - 6 hours;
- NOMID patients = 5.7 hours (range of 3.1 - 28.2 hours). </half-life>
- <protein-binding/>
- <route-of-elimination/>
- <volume-of-distribution/>
- <clearance>Clearance is variable and increases with increasing creatinine clearance and body weight. However, gender and age were not significant factors. </clearance>
- <classification>
- <description/>
- <direct-parent>Peptides</direct-parent>
- <kingdom>Organic Compounds</kingdom>
- <superclass>Organic Acids</superclass>
- <class>Carboxylic Acids and Derivatives</class>
- <subclass>Amino Acids, Peptides, and Analogues</subclass>
- </classification>
- <salts/>
- <synonyms>
- <synonym language="" coder="">ICIL-1RA</synonym>
- <synonym language="" coder="">IL-1ra</synonym>
- <synonym language="" coder="">IL-1RN</synonym>
- <synonym language="" coder="">IL1 inhibitor</synonym>
- <synonym language="" coder="">Interleukin-1 receptor antagonist protein precursor</synonym>
- <synonym language="" coder="">IRAP</synonym>
- </synonyms>
- <products>
- <product>
- <name>Kineret</name>
- <ndc-id/>
- <ndc-product-code/>
- <dpd-id>02245913</dpd-id>
- <started-marketing-on>2002-05-29</started-marketing-on>
- <ended-marketing-on/>
- <dosage-form>solution</dosage-form>
- <strength>150 mg</strength>
- <route>subcutaneous</route>
- <fda-application-number/>
- <generic>false</generic>
- <over-the-counter>false</over-the-counter>
- <approved>true</approved>
- <country>Canada</country>
- <source>DPD</source>
- </product>
- <product>
- <name>Kineret</name>
- <ndc-id>66658-234_5888e955-91e4-4c46-95bb-46e7ba8d0aa1</ndc-id>
- <ndc-product-code>66658-234</ndc-product-code>
- <dpd-id/>
- <started-marketing-on>2009-12-15</started-marketing-on>
- <ended-marketing-on/>
- <dosage-form>injection, solution</dosage-form>
- <strength>100 mg/.67mL</strength>
- <route>subcutaneous</route>
- <fda-application-number>BLA103950</fda-application-number>
- <generic>false</generic>
- <over-the-counter>false</over-the-counter>
- <approved>true</approved>
- <country>US</country>
- <source>FDA NDC</source>
- </product>
- </products>
- <international-brands/>
- <mixtures>
- <mixture>
- <name>Kineret</name>
- <ingredients>Anakinra</ingredients>
- </mixture>
- <mixture>
- <name>Kineret</name>
- <ingredients>Anakinra</ingredients>
- </mixture>
- </mixtures>
- <packagers>
- <packager>
- <name>Amgen Inc.</name>
- <url>http://www.amgen.com</url>
- </packager>
- <packager>
- <name>BioVitrum AB</name>
- <url>http://www.biovitrum.com</url>
- </packager>
- </packagers>
- <manufacturers/>
- <prices>
- <price>
- <description>Kineret 100 mg/0.67 ml syr</description>
- <cost currency="USD">61.8</cost>
- <unit>syringe</unit>
- </price>
- <price>
- <description>Kineret 1 Box = 7 Syringes, 4.69ml Box</description>
- <cost currency="USD">449.9</cost>
- <unit>box</unit>
- </price>
- </prices>
- <categories>
- <category>
- <category>Antirheumatic Agents</category>
- <mesh-id/>
- </category>
- <category>
- <category>Immunosuppressive Agents</category>
- <mesh-id/>
- </category>
- </categories>
- <affected-organisms>
- <affected-organism>Humans and other mammals</affected-organism>
- </affected-organisms>
- <dosages>
- <dosage>
- <form>Injection, solution</form>
- <route>subcutaneous</route>
- <strength>100 mg/.67mL</strength>
- </dosage>
- <dosage>
- <form>Solution</form>
- <route>subcutaneous</route>
- <strength>150 mg</strength>
- </dosage>
- </dosages>
- <atc-codes>
- <atc-code code="L04AC03">
- <level code="L">ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS</level>
- <level code="L04">IMMUNOSUPPRESSANTS</level>
- <level code="L04A">IMMUNOSUPPRESSANTS</level>
- <level code="L04AC">Interleukin inhibitors</level>
- </atc-code>
- </atc-codes>
- <ahfs-codes>
- <ahfs-code>92:00.00</ahfs-code>
- </ahfs-codes>
- <patents>
- <patent>
- <number>1341322</number>
- <country>Canada</country>
- <approved>2001-11-27</approved>
- <expires>2018-11-27</expires>
- </patent>
- <patent>
- <number>2141953</number>
- <country>Canada</country>
- <approved>2008-04-08</approved>
- <expires>2013-09-17</expires>
- </patent>
- </patents>
- <food-interactions/>
- <drug-interactions>
- <drug-interaction>
- <drugbank-id>DB01281</drugbank-id>
- <name>Abatacept</name>
- <description>Anakinra may enhance the adverse/toxic effect of Abatacept.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB00051</drugbank-id>
- <name>Adalimumab</name>
- <description>Anti-TNF Agents may enhance the adverse/toxic effect of Anakinra. An increased risk of serious infection during concomitant use has been reported.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB06168</drugbank-id>
- <name>Canakinumab</name>
- <description>Interleukin-1 Receptor Antagonist may enhance the adverse/toxic effect of Canakinumab. Whether such a combination will also alter the therapeutic response to one or both agents is unclear.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB08904</drugbank-id>
- <name>Certolizumab pegol</name>
- <description>Anti-TNF Agents may enhance the adverse/toxic effect of Anakinra. An increased risk of serious infection during concomitant use has been reported.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB06643</drugbank-id>
- <name>Denosumab</name>
- <description>May enhance the adverse/toxic effect of Immunosuppressants. Specifically, the risk for serious infections may be increased.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB00005</drugbank-id>
- <name>Etanercept</name>
- <description>Anti-TNF Agents may enhance the adverse/toxic effect of Anakinra. An increased risk of serious infection during concomitant use has been reported.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB06674</drugbank-id>
- <name>golimumab</name>
- <description>Anti-TNF Agents may enhance the adverse/toxic effect of Anakinra. An increased risk of serious infection during concomitant use has been reported.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB00065</drugbank-id>
- <name>Infliximab</name>
- <description>Anti-TNF Agents may enhance the adverse/toxic effect of Anakinra. An increased risk of serious infection during concomitant use has been reported.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB01097</drugbank-id>
- <name>Leflunomide</name>
- <description>Immunosuppressants may enhance the adverse/toxic effect of Leflunomide. Specifically, the risk for hematologic toxicity such as pancytopenia, agranulocytosis, and/or thrombocytopenia may be increased.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB00480</drugbank-id>
- <name>Lenalidomide</name>
- <description>Anti-TNF Agents may enhance the adverse/toxic effect of Anakinra. An increased risk of serious infection during concomitant use has been reported.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB00108</drugbank-id>
- <name>Natalizumab</name>
- <description>Immunosuppressants may enhance the adverse/toxic effect of Natalizumab. Specifically, the risk of concurrent infection may be increased.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB00337</drugbank-id>
- <name>Pimecrolimus</name>
- <description>May enhance the adverse/toxic effect of Immunosuppressants.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB08910</drugbank-id>
- <name>Pomalidomide</name>
- <description>Anti-TNF Agents may enhance the adverse/toxic effect of Anakinra. An increased risk of serious infection during concomitant use has been reported.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB01656</drugbank-id>
- <name>Roflumilast</name>
- <description>May enhance the immunosuppressive effect of Immunosuppressants.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB06688</drugbank-id>
- <name>Sipuleucel-T</name>
- <description>Immunosuppressants may diminish the therapeutic effect of Sipuleucel-T.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB01041</drugbank-id>
- <name>Thalidomide</name>
- <description>Anti-TNF Agents may enhance the adverse/toxic effect of Anakinra. An increased risk of serious infection during concomitant use has been reported.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB08895</drugbank-id>
- <name>Tofacitinib</name>
- <description>Anakinra may enhance the adverse/toxic effect of Tofacitinib.</description>
- </drug-interaction>
- <drug-interaction>
- <drugbank-id>DB00072</drugbank-id>
- <name>Trastuzumab</name>
- <description>May enhance the neutropenic effect of Immunosuppressants.</description>
- </drug-interaction>
- </drug-interactions>
- <sequences>
- <sequence format="FASTA">>DB00026 sequence
- MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLG
- IHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGW
- FLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE</sequence>
- </sequences>
- <experimental-properties>
- <property>
- <kind>Hydrophobicity</kind>
- <value>-0.412</value>
- <source/>
- </property>
- <property>
- <kind>Isoelectric Point</kind>
- <value>5.46</value>
- <source/>
- </property>
- <property>
- <kind>Molecular Weight</kind>
- <value>17257.6000</value>
- <source/>
- </property>
- <property>
- <kind>Molecular Formula</kind>
- <value>C759H1186N208O232S10</value>
- <source/>
- </property>
- </experimental-properties>
- <external-identifiers>
- <external-identifier>
- <resource>Drugs Product Database (DPD)</resource>
- <identifier>12604</identifier>
- </external-identifier>
- <external-identifier>
- <resource>KEGG Drug</resource>
- <identifier>D02934</identifier>
- </external-identifier>
- <external-identifier>
- <resource>National Drug Code Directory</resource>
- <identifier>66658-234-28</identifier>
- </external-identifier>
- <external-identifier>
- <resource>GenBank</resource>
- <identifier>M55646</identifier>
- </external-identifier>
- <external-identifier>
- <resource>PharmGKB</resource>
- <identifier>PA10799</identifier>
- </external-identifier>
- <external-identifier>
- <resource>UniProtKB</resource>
- <identifier>P18510</identifier>
- </external-identifier>
- <external-identifier>
- <resource>Wikipedia</resource>
- <identifier>Anakinra</identifier>
- </external-identifier>
- </external-identifiers>
- <external-links>
- <external-link>
- <resource>RxList</resource>
- <url>http://www.rxlist.com/cgi/generic/anakinra.htm</url>
- </external-link>
- <external-link>
- <resource>Drugs.com</resource>
- <url>http://www.drugs.com/cdi/anakinra.html</url>
- </external-link>
- </external-links>
- <pathways/>
- <reactions/>
- <snp-effects/>
- <snp-adverse-drug-reactions/>
- <targets>
- <target position="1">
- <id>BE0000565</id>
- <name>Interleukin-1 receptor type 1</name>
- <organism>Human</organism>
- <actions>
- <action>antagonist</action>
- </actions>
- <references># Tang YH, Zhang SP, Liang Y, Deng CQ: [Effects of Panax notoginseng saponins on mRNA expressions of interleukin-1 beta, its correlative factors and cysteinyl-aspartate specific protease after cerebral ischemia-reperfusion in rats] Zhong Xi Yi Jie He Xue Bao. 2007 May;5(3):328-32. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17498496
- # Dayer JM: The pivotal role of interleukin-1 in the clinical manifestations of rheumatoid arthritis. Rheumatology (Oxford). 2003 May;42 Suppl 2:ii3-10. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/12817089
- # Vamvakopoulos J, Green C, Metcalfe S: Genetic control of IL-1beta bioactivity through differential regulation of the IL-1 receptor antagonist. Eur J Immunol. 2002 Oct;32(10):2988-96. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/12355453
- # Do H, Vasilescu A, Carpentier W, Meyer L, Diop G, Hirtzig T, Coulonges C, Labib T, Spadoni JL, Therwath A, Lathrop M, Matsuda F, Zagury JF: Exhaustive genotyping of the interleukin-1 family genes and associations with AIDS progression in a French cohort. J Infect Dis. 2006 Dec 1;194(11):1492-504. Epub 2006 Oct 26. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17083033
- # Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/11752352
- # So A, De Smedt T, Revaz S, Tschopp J: A pilot study of IL-1 inhibition by anakinra in acute gout. Arthritis Res Ther. 2007;9(2):R28. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17352828
- # Vannier E, Kaser A, Atkins MB, Fantuzzi G, Dinarello CA, Mier JW, Tilg H: Elevated circulating levels of soluble interleukin-1 receptor type II during interleukin-2 immunotherapy. Eur Cytokine Netw. 1999 Mar;10(1):37-42. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/10210771</references>
- <known-action>yes</known-action>
- <polypeptide id="P14778" source="Swiss-Prot">
- <name>Interleukin-1 receptor type 1</name>
- <general-function>Involved in transmembrane receptor activity</general-function>
- <specific-function>Receptor for interleukin-1 alpha (IL-1A), beta (IL-1B), and interleukin-1 receptor antagonist protein (IL-1RA). Binding to the agonist leads to the activation of NF-kappa-B. Signaling involves formation of a ternary complex containing IL1RAP, TOLLIP, MYD88, and IRAK1 or IRAK2</specific-function>
- <gene-name>IL1R1</gene-name>
- <locus>2q12</locus>
- <cellular-location>Membrane; single-pass type I membrane protein</cellular-location>
- <transmembrane-regions>337-356</transmembrane-regions>
- <signal-regions/>
- <theoretical-pi>7.89</theoretical-pi>
- <molecular-weight>65403.0</molecular-weight>
- <chromosome-location/>
- <organism ncbi-taxonomy-id="9606">Human</organism>
- <external-identifiers>
- <external-identifier>
- <resource>HUGO Gene Nomenclature Committee (HGNC)</resource>
- <identifier>HGNC:5993</identifier>
- </external-identifier>
- <external-identifier>
- <resource>GenAtlas</resource>
- <identifier>IL1R1</identifier>
- </external-identifier>
- <external-identifier>
- <resource>GeneCards</resource>
- <identifier>IL1R1</identifier>
- </external-identifier>
- <external-identifier>
- <resource>GenBank Gene Database</resource>
- <identifier>X16896</identifier>
- </external-identifier>
- <external-identifier>
- <resource>GenBank Protein Database</resource>
- <identifier>33801</identifier>
- </external-identifier>
- <external-identifier>
- <resource>UniProtKB</resource>
- <identifier>P14778</identifier>
- </external-identifier>
- <external-identifier>
- <resource>UniProt Accession</resource>
- <identifier>IL1R1_HUMAN</identifier>
- </external-identifier>
- </external-identifiers>
- <synonyms>
- <synonym>CD121a antigen</synonym>
- <synonym>IL-1R- alpha</synonym>
- <synonym>IL-1R-1</synonym>
- <synonym>IL-1RT1</synonym>
- <synonym>Interleukin-1 receptor type I precursor</synonym>
- <synonym>p80</synonym>
- </synonyms>
- <amino-acid-sequence format="FASTA">>Interleukin-1 receptor type I precursor
- MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
- DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL
- CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
- LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
- GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
- IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
- IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
- YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
- DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
- QRRSPSSKHQLLSPATKEKLQREAHVPLG</amino-acid-sequence>
- <gene-sequence format="FASTA">>1710 bp
- ATGAAAGTGTTACTCAGACTTATTTGTTTCATAGCTCTACTGATTTCTTCTCTGGAGGCT
- GATAAATGCAAGGAACGTGAAGAAAAAATAATTTTAGTGTCATCTGCAAATGAAATTGAT
- GTTCGTCCCTGTCCTCTTAACCCAAATGAACACAAAGGCACTATAACTTGGTATAAAGAT
- GACAGCAAGACACCTGTATCTACAGAACAAGCCTCCAGGATTCATCAACACAAAGAGAAA
- CTTTGGTTTGTTCCTGCTAAGGTGGAGGATTCAGGACATTACTATTGCGTGGTAAGAAAT
- TCATCTTACTGCCTCAGAATTAAAATAAGTGCAAAATTTGTGGAGAATGAGCCTAACTTA
- TGTTATAATGCACAAGCCATATTTAAGCAGAAACTACCCGTTGCAGGAGACGGAGGACTT
- GTGTGCCCTTATATGGAGTTTTTTAAAAATGAAAATAATGAGTTACCTAAATTACAGTGG
- TATAAGGATTGCAAACCTCTACTTCTTGACAATATACACTTTAGTGGAGTCAAAGATAGG
- CTCATCGTGATGAATGTGGCTGAAAAGCATAGAGGGAACTATACTTGTCATGCATCCTAC
- ACATACTTGGGCAAGCAATATCCTATTACCCGGGTAATAGAATTTATTACTCTAGAGGAA
- AACAAACCCACAAGGCCTGTGATTGTGAGCCCAGCTAATGAGACAATGGAAGTAGACTTG
- GGATCCCAGATACAATTGATCTGTAATGTCACCGGCCAGTTGAGTGACATTGCTTACTGG
- AAGTGGAATGGGTCAGTAATTGATGAAGATGACCCAGTGCTAGGGGAAGACTATTACAGT
- GTGGAAAATCCTGCAAACAAAAGAAGGAGTACCCTCATCACAGTGCTTAATATATCGGAA
- ATTGAAAGTAGATTTTATAAACATCCATTTACCTGTTTTGCCAAGAATACACATGGTATA
- GATGCAGCATATATCCAGTTAATATATCCAGTCACTAATTTCCAGAAGCACATGATTGGT
- ATATGTGTCACGTTGACAGTCATAATTGTGTGTTCTGTTTTCATCTATAAAATCTTCAAG
- ATTGACATTGTGCTTTGGTACAGGGATTCCTGCTATGATTTTCTCCCAATAAAAGCTTCA
- GATGGAAAGACCTATGACGCATATATACTGTATCCAAAGACTGTTGGGGAAGGGTCTACC
- TCTGACTGTGATATTTTTGTGTTTAAAGTCTTGCCTGAGGTCTTGGAAAAACAGTGTGGA
- TATAAGCTGTTCATTTATGGAAGGGATGACTACGTTGGGGAAGACATTGTTGAGGTCATT
- AATGAAAACGTAAAGAAAAGCAGAAGACTGATTATCATTTTAGTCAGAGAAACATCAGGC
- TTCAGCTGGCTGGGTGGTTCATCTGAAGAGCAAATAGCCATGTATAATGCTCTTGTTCAG
- GATGGAATTAAAGTTGTCCTGCTTGAGCTGGAGAAAATCCAAGACTATGAGAAAATGCCA
- GAATCGATTAAATTCATTAAGCAGAAACATGGGGCTATCCGCTGGTCAGGGGACTTTACA
- CAGGGACCACAGTCTGCAAAGACAAGGTTCTGGAAGAATGTCAGGTACCACATGCCAGTC
- CAGCGACGGTCACCTTCATCTAAACACCAGTTACTGTCACCAGCCACTAAGGAGAAACTG
- CAAAGAGAGGCTCACGTGCCTCTCGGGTAG</gene-sequence>
- <pfams>
- <pfam>
- <identifier>PF00047</identifier>
- <name>ig</name>
- </pfam>
- <pfam>
- <identifier>PF01582</identifier>
- <name>TIR</name>
- </pfam>
- </pfams>
- <go-classifiers>
- <go-classifier>
- <category>component</category>
- <description>cell</description>
- </go-classifier>
- <go-classifier>
- <category>component</category>
- <description>membrane</description>
- </go-classifier>
- <go-classifier>
- <category>function</category>
- <description>interleukin-1 receptor activity</description>
- </go-classifier>
- <go-classifier>
- <category>function</category>
- <description>signal transducer activity</description>
- </go-classifier>
- <go-classifier>
- <category>function</category>
- <description>receptor activity</description>
- </go-classifier>
- <go-classifier>
- <category>function</category>
- <description>transmembrane receptor activity</description>
- </go-classifier>
- <go-classifier>
- <category>function</category>
- <description>hematopoietin/interferon-class (D200-domain) cytokine receptor activity</description>
- </go-classifier>
- <go-classifier>
- <category>function</category>
- <description>interleukin-1, Type I, activating receptor activity</description>
- </go-classifier>
- <go-classifier>
- <category>function</category>
- <description>interleukin receptor activity</description>
- </go-classifier>
- </go-classifiers>
- </polypeptide>
- </target>
- </targets>
- <enzymes/>
- <carriers/>
- <transporters/>
- </drug>
Advertisement
Add Comment
Please, Sign In to add comment