SHARE
TWEET

Mac Diagnostic Output

gvantass Nov 14th, 2015 2,061 Never
Not a member of Pastebin yet? Sign Up, it unlocks many cool features!
  1.    1  Start time: 01:36:10 11/14/15
  2.    2  
  3.    3  Revision: 1368
  4.    4  
  5.    5  Model Identifier: iMac11,3
  6.    6  System Version: OS X 10.11.1 (15B42)
  7.    7  Kernel Version: Darwin 15.0.0
  8.    8  Time since boot: 11 minutes
  9.    9  
  10.   10  SerialATA
  11.   11  
  12.   12      WDC WD1001FALS-40Y6A0                  
  13.   13  
  14.   14  USB
  15.   15  
  16.   16      My Book 1230 (Western Digital Technologies, Inc.)
  17.   17      2.4G Keyboard Mouse (ProVision Technology, Inc.)
  18.   18  
  19.   19  Energy (lifetime)
  20.   20  
  21.   21      kernel_task (UID 0): 17.32
  22.   22      com.apple.WebKit.WebContent (UID 501): 7.38
  23.   23  
  24.   24  Energy (sampled)
  25.   25  
  26.   26      kernel_task (UID 0): 11.33
  27.   27      com.apple.WebKit.WebContent (UID 501): 9.56
  28.   28  
  29.   29  Global prefs (system)
  30.   30  
  31.   31      MultipleSessionEnabled = 1
  32.   32  
  33.   33  Trust settings: admin 6, user 12
  34.   34  
  35.   35  Firewall: On
  36.   36  
  37.   37  DNS: 208.67.222.222 (static)
  38.   38  
  39.   39  Listeners
  40.   40  
  41.   41      kdc: kerberos
  42.   42      launchd: afpovertcp
  43.   43      launchd: ftp
  44.   44      launchd: microsoft-ds
  45.   45      launchd: ssh
  46.   46  
  47.   47  Diagnostic reports
  48.   48  
  49.   49      2015-10-25 Paragon Updater hang
  50.   50      2015-10-26 iTunes hang
  51.   51      2015-10-27 AppYM hang
  52.   52      2015-10-27 Little_Snitch_Agent_1679.spindump.txt txt
  53.   53      2015-10-27 MusicManagerHelper crash x2
  54.   54      2015-10-27 postflightinit crash x2
  55.   55      2015-10-31 iTunes hang
  56.   56      2015-11-03 MusicManagerHelper crash
  57.   57      2015-11-03 mds crash
  58.   58      2015-11-06 Snagit hang
  59.   59      2015-11-07 MusicManagerHelper crash
  60.   60      2015-11-08 Kernel panic
  61.   61      2015-11-08 Little_Snitch_Agent_3213.spindump.txt txt
  62.   62      2015-11-09 Kernel panic
  63.   63      2015-11-09 MusicManagerHelper crash
  64.   64      2015-11-09 Plex Media Server crash
  65.   65      2015-11-11 MusicManagerHelper crash
  66.   66      2015-11-11 suggestd crash x2
  67.   67      2015-11-13 Little_Snitch_Agent_10674.spindump.txt txt
  68.   68      2015-11-13 Little_Snitch_Agent_1629.spindump.txt txt
  69.   69      2015-11-13 Little_Snitch_Agent_2902.spindump.txt txt
  70.   70      2015-11-13 Little_Snitch_Agent_375.spindump.txt txt
  71.   71      2015-11-13 Little_Snitch_Agent_41568.spindump.txt txt
  72.   72      2015-11-13 Little_Snitch_Agent_579.spindump.txt txt
  73.   73      2015-11-13 Little_Snitch_Agent_6273.spindump.txt txt
  74.   74  
  75.   75  HID errors: 3
  76.   76  
  77.   77  Kernel log
  78.   78  
  79.   79      Nov 13 01:08:15 firefox[832] triggered unnest of range 0x7fff8b400000->0x7fff8b600000 of DYLD shared region in VM map 0x853b03b1f9bce77f. While not abnormal for debuggers, this increases system memory footprint until the target exits.
  80.   80      Nov 13 01:40:59 Safari[2875] triggered unnest of range 0x7fff89c00000->0x7fff89e00000 of DYLD shared region in VM map 0x853b03b1faa47bdf. While not abnormal for debuggers, this increases system memory footprint until the target exits.
  81.   81      Nov 13 01:50:25 [IOBluetoothHostController][handleACLPacketTimeout] -- Disconnecting due to device not responding (ACL Packet timed out) for connection handle 0xe
  82.   82      Nov 13 06:32:02 Over-release of kernel-internal importance assertions for pid 483 (Little Snitch Ne), dropping 1 assertion(s) but task only has 0 remaining (0 external).
  83.   83      Nov 13 07:38:47 msdosfs_update_fsinfo: error 6 reading FSInfo
  84.   84      Nov 13 07:38:51 msdosfs_fat_uninit_vol: error 6 from msdosfs_fat_cache_flush
  85.   85      Nov 13 15:49:32 msdosfs_update_fsinfo: error 6 reading FSInfo
  86.   86      Nov 13 15:49:32 msdosfs_fat_uninit_vol: error 6 from msdosfs_fat_cache_flush
  87.   87      Nov 13 19:42:03 firefox[62276] triggered unnest of range 0x7fff8b400000->0x7fff8b600000 of DYLD shared region in VM map 0x853b03b1e9d46dcf. While not abnormal for debuggers, this increases system memory footprint until the target exits.
  88.   88      Nov 13 21:47:58 075247.575016 IOUSBHostHIDDevice@fd133400,1: IOUSBHostHIDDevice::interruptRetry: resetting device due to IO failures
  89.   89      Nov 13 22:47:10 decmpfs.c:1432:decmpfs_read_compressed: /System/Library/Frameworks/CoreGraphics.framework/Versions/A/Resources/libCMaps.A.dylib: cluster_copy_upl_data err 14
  90.   90      Nov 13 22:47:10 decmpfs.c:1456:decmpfs_read_compressed: /System/Library/Frameworks/CoreGraphics.framework/Versions/A/Resources/libCMaps.A.dylib: err 14
  91.   91      Nov 14 00:12:38 decmpfs.c:1432:decmpfs_read_compressed: /System/Library/Frameworks/Quartz.framework/Versions/A/Frameworks/QuickLookUI.framework/Versions/A/PlugIns/Web.qldisplay/Contents/MacOS/Web: cluster_copy_upl_data err 14
  92.   92      Nov 14 00:12:38 decmpfs.c:1456:decmpfs_read_compressed: /System/Library/Frameworks/Quartz.framework/Versions/A/Frameworks/QuickLookUI.framework/Versions/A/PlugIns/Web.qldisplay/Contents/MacOS/Web: err 14
  93.   93      Nov 14 00:19:48 firefox[87260] triggered unnest of range 0x7fff8b400000->0x7fff8b600000 of DYLD shared region in VM map 0x853b03b1f8522d4f. While not abnormal for debuggers, this increases system memory footprint until the target exits.
  94.   94      Nov 14 01:04:37 firefox[93578] triggered unnest of range 0x7fff8b400000->0x7fff8b600000 of DYLD shared region in VM map 0x853b03b1fc0af8f7. While not abnormal for debuggers, this increases system memory footprint until the target exits.
  95.   95      Nov 14 01:22:19 Process launchd [1] disabling system-wide I/O Throttling
  96.   96      Nov 14 01:22:19 Process launchd [1] disabling system-wide CPU Throttling
  97.   97      Nov 14 01:27:04 IO80211ControllerMonitor::configureSubscriptions() failed to add subscriptionIO80211Controller::start _controller is 0x71202fb2b765ad8f, provider is 0x71202fb1f8353c8f
  98.   98      Nov 14 01:27:04 000001.426291 StandardUSB::validateEndpointMaxPacketSize: USB 2.0 5.[5-8].3: endpoint 0x00 invalid wMaxPacketSize 0x0008
  99.   99      Nov 14 01:27:04 init: error getting PHY_MODE;  using MODE_UNKNOWN
  100.  100      Nov 14 01:27:15 ** GPU Hardware VM is disabled (multispace: disabled, page table updates with DMA: disabled, non-contiguous VRAM: disabled)
  101.  101      Nov 14 01:27:52 utun_start: ifnet_disable_output returned error 12
  102.  102      Nov 14 01:28:32 firefox[357] triggered unnest of range 0x7fff93e00000->0x7fff94000000 of DYLD shared region in VM map 0xb77a29fb5ee05e6f. While not abnormal for debuggers, this increases system memory footprint until the target exits.
  103.  103      Nov 14 01:31:26 000338.542627 IOUSBHostHIDDevice@fd133400,1: IOUSBHostHIDDevice::interruptRetry: resetting device due to IO failures
  104.  104  
  105.  105  System log
  106.  106  
  107.  107      Nov 14 02:41:35 fseventsd: requested timestamp is prior to the earliest log file.  setting event-id to zero
  108.  108      Nov 14 02:42:01 fseventsd: requested timestamp is prior to the earliest log file.  setting event-id to zero
  109.  109      Nov 14 02:43:37 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
  110.  110      Nov 14 02:43:39 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
  111.  111      Nov 14 02:43:56 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
  112.  112      Nov 14 02:44:17 fseventsd: requested timestamp is prior to the earliest log file.  setting event-id to zero
  113.  113      Nov 14 02:44:17 fseventsd: requested timestamp is prior to the earliest log file.  setting event-id to zero
  114.  114      Nov 14 02:44:17 fseventsd: requested timestamp is prior to the earliest log file.  setting event-id to zero
  115.  115      Nov 14 02:44:17 fseventsd: requested timestamp is prior to the earliest log file.  setting event-id to zero
  116.  116      Nov 14 02:44:56 Safari: tcp_connection_tls_session_error_callback_imp 279 __tcp_connection_tls_session_callback_write_block_invoke.434 error 22
  117.  117      Nov 14 02:46:09 WindowServer: disable_update_timeout: UI updates were forcibly disabled by application "Little Snitch Agent" for over 1.00 seconds. Server has re-enabled them.
  118.  118      Nov 14 02:47:50 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
  119.  119      Nov 14 02:47:51 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
  120.  120      Nov 14 02:48:05 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
  121.  121      Nov 14 02:48:20 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
  122.  122      Nov 14 02:48:33 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
  123.  123      Nov 14 02:48:59 WindowServer: disable_update_timeout: UI updates were forcibly disabled by application "Airmail" for over 1.00 seconds. Server has re-enabled them.
  124.  124      Nov 14 02:50:20 WindowServer: disable_update_timeout: UI updates were forcibly disabled by application "Airmail" for over 1.00 seconds. Server has re-enabled them.
  125.  125      Nov 14 02:50:23 cloudd: MMCSEngineClientContextGetItemReaderForItem:120 failed getItemReaderForItemCallback
  126.  126      Nov 14 02:50:28 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
  127.  127      Nov 14 02:50:38 cloudd: MMCSEngineClientContextGetItemReaderForItem:120 failed getItemReaderForItemCallback
  128.  128      Nov 14 02:50:38 WindowServer: disable_update_timeout: UI updates were forcibly disabled by application "Airmail" for over 1.00 seconds. Server has re-enabled them.
  129.  129      Nov 14 02:50:45 cloudd: MMCSEngineClientContextGetItemReaderForItem:120 failed getItemReaderForItemCallback
  130.  130      Nov 14 02:51:10 cloudd: MMCSEngineClientContextGetItemReaderForItem:120 failed getItemReaderForItemCallback
  131.  131      Nov 14 02:51:14 cloudd: MMCSEngineClientContextGetItemReaderForItem:120 failed getItemReaderForItemCallback
  132.  132  
  133.  133  launchd log
  134.  134  
  135.  135      Nov 14 01:27:26 com.apple.xpc.launchd.domain.pid.virusbarrierd.108: Could not resolve origin of domain. XPC services in this domain's bundle will not be bootstrapped: error = 107: Malformed bundle, taint = missing executable
  136.  136      Nov 14 01:28:00 com.apple.xpc.launchd.domain.system: Caller not allowed to perform action: SecurityAgent.317, action = legacy spawn, code = 1: Operation not permitted, uid = 92, euid = 92, gid = 92, egid = 92, asid = 100007
  137.  137      Nov 14 01:28:24 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: path = /System/Library/LaunchAgents/com.apple.CommCenter-osx.plist, caller = loginwindow.121, error = 138: Service cannot be loaded on this hardware
  138.  138      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.edovia.screens.launcher, error = 119: Service is disabled
  139.  139      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.lifewaresolutions.DeluxeMoonHDMacHelper, error = 119: Service is disabled
  140.  140      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = org.tempel.findanyfile.hotkey, error = 119: Service is disabled
  141.  141      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.eltima.Folx3.FolxScheduleHelper, error = 119: Service is disabled
  142.  142      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.growl.GrowlLauncher, error = 119: Service is disabled
  143.  143      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.vinnov.LivingWallpaperHDfreeHelper, error = 119: Service is disabled
  144.  144      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.vinnov.LivingWeatherHDHelper, error = 119: Service is disabled
  145.  145      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.microsoft.SkyDriveLauncher, error = 119: Service is disabled
  146.  146      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.microsoft.OneDriveLauncher, error = 119: Service is disabled
  147.  147      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.pushbullet.macapp-notifications, error = 119: Service is disabled
  148.  148      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.apparentsoft.TricksterLauncher, error = 119: Service is disabled
  149.  149      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.eurosmartz.pushhelper, error = 119: Service is disabled
  150.  150      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.uglyapps.HocusFocusHelper, error = 119: Service is disabled
  151.  151      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.microsoft.OneDriveBusinessMacLauncher, error = 119: Service is disabled
  152.  152      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.eltima.SyncMate.com.eltima.SyncMateService, error = 119: Service is disabled
  153.  153      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.eltima.tp2.agent, error = 119: Service is disabled
  154.  154      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.dmitrynikolaev.numi2helper, error = 119: Service is disabled
  155.  155      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.urbanapps.hourlynews.mac.launcher, error = 119: Service is disabled
  156.  156      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.sweetpproductions.DesktopUtilityHelper, error = 119: Service is disabled
  157.  157      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.intego.WashingMachine.ui.helper, error = 119: Service is disabled
  158.  158      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.if.Amphetamine.LaunchAtLoginHelper, error = 119: Service is disabled
  159.  159      Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.devon-technologies.agentexpress, error = 119: Service is disabled
  160.  160  
  161.  161  Console log
  162.  162  
  163.  163      Nov 13 01:10:45 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/VLCStreamer_UUID.plist.
  164.  164      Nov 13 01:14:44 Fantastical 2: Fantastical 2.app (224) launching
  165.  165      Nov 13 01:14:55 Fantastical 2: System version: Version 10.11.1 (Build 15B42)
  166.  166      Nov 13 01:14:55 Fantastical 2: DDLog level: 1
  167.  167      Nov 13 01:14:55 Fantastical 2: Mac App Store
  168.  168      Nov 13 03:14:28 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/quicklookd_UUID.plist.
  169.  169      Nov 13 08:35:13 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/com.apple.WebKit.Plugin.64_UUID.plist.
  170.  170      Nov 13 19:52:27 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/quicklookd_UUID.plist.
  171.  171      Nov 13 22:52:48 Fantastical 2 Today Widget: Fantastical 2 Today Widget.appex (224) launching
  172.  172      Nov 13 22:52:59 Fantastical 2 Today Widget: System version: Version 10.11.1 (Build 15B42)
  173.  173      Nov 13 22:52:59 Fantastical 2 Today Widget: DDLog level: 1
  174.  174      Nov 13 22:53:00 Fantastical 2 Today Widget: Fantastical 2 Today Widget.appex (224) launching
  175.  175      Nov 13 22:53:00 Fantastical 2 Today Widget: Fantastical 2 Today Widget.appex (224) launching
  176.  176      Nov 13 22:53:00 Fantastical 2 Today Widget: System version: Version 10.11.1 (Build 15B42)
  177.  177      Nov 13 22:53:00 Fantastical 2 Today Widget: System version: Version 10.11.1 (Build 15B42)
  178.  178      Nov 13 22:53:00 Fantastical 2 Today Widget: DDLog level: 1
  179.  179      Nov 13 22:53:00 Fantastical 2 Today Widget: DDLog level: 1
  180.  180      Nov 13 23:04:37 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/Today_UUID.plist.
  181.  181      Nov 14 01:39:28 Fantastical 2: Fantastical 2.app (224) launching
  182.  182      Nov 14 01:39:42 Fantastical 2: System version: Version 10.11.1 (Build 15B42)
  183.  183      Nov 14 01:39:42 Fantastical 2: DDLog level: 1
  184.  184      Nov 14 01:39:42 Fantastical 2: Mac App Store
  185.  185      Nov 14 01:50:22 Fantastical 2 Today Widget: Fantastical 2 Today Widget.appex (224) launching
  186.  186      Nov 14 01:50:35 Fantastical 2 Today Widget: System version: Version 10.11.1 (Build 15B42)
  187.  187      Nov 14 01:50:35 Fantastical 2 Today Widget: DDLog level: 1
  188.  188  
  189.  189  Loaded kernel extensions
  190.  190  
  191.  191      at.obdev.nke.LittleSnitch (4352)
  192.  192      com.Cycling74.driver.Soundflower (1.6.7)
  193.  193      com.globaldelight.driver.Boom2Device (1.1)
  194.  194      com.kaspersky.kext.klif (3.0.2a39)
  195.  195      com.kaspersky.nke (1.6.2a12)
  196.  196      com.paragon-software.filesystems.ntfs (543.0.14)
  197.  197      com.splashtop.driver.SRXDisplayCard (1.6)
  198.  198      com.splashtop.driver.SRXFrameBufferConnector (1.6)
  199.  199      com.techsmith.TACC (1.0.3)
  200.  200      com.wdc.driver.USB.64.10.9 (1.0.1)
  201.  201  
  202.  202  System services loaded
  203.  203  
  204.  204      at.obdev.littlesnitchd
  205.  205      com.adobe.fpsaud
  206.  206      com.ambrosiasw.ambrosiaaudiosupporthelper.daemon
  207.  207      com.apple.AccountPolicyHelper
  208.  208      com.apple.AmbientDisplayAgent
  209.  209      com.apple.CodeSigningHelper
  210.  210      com.apple.Kerberos.kdc
  211.  211      -     status: 1
  212.  212      com.apple.MobileFileIntegrity
  213.  213      com.apple.PerformanceAnalysis.animationperfd
  214.  214      com.apple.aslmanager
  215.  215      com.apple.audio.systemsoundserverd
  216.  216      com.apple.awdd
  217.  217      com.apple.cache_delete
  218.  218      com.apple.coreduetd
  219.  219      com.apple.coresymbolicationd
  220.  220      com.apple.ctkd
  221.  221      com.apple.diagnosticd
  222.  222      com.apple.emond.aslmanager
  223.  223      com.apple.icloud.findmydeviced
  224.  224      com.apple.iconservices.iconservicesagent
  225.  225      com.apple.iconservices.iconservicesd
  226.  226      com.apple.ifdreader
  227.  227      com.apple.installd
  228.  228      com.apple.logd
  229.  229      -     status: 1
  230.  230      com.apple.nehelper
  231.  231      com.apple.networkd_privileged
  232.  232      com.apple.nsurlsessiond_privileged
  233.  233      com.apple.nsurlstoraged
  234.  234      com.apple.sandboxd
  235.  235      com.apple.secinitd
  236.  236      com.apple.softwareupdated
  237.  237      com.apple.sysmond
  238.  238      com.apple.tccd.system
  239.  239      com.apple.watchdogd
  240.  240      com.apple.wdhelper
  241.  241      com.apple.xpc.smd
  242.  242      com.bresink.system.securityagent3a
  243.  243      com.chungwasoft.shimo.helper
  244.  244      com.disconnect.networklistener
  245.  245      com.edovia.screensconnect.daemon
  246.  246      com.eltima.ElmediaPlayer.daemon
  247.  247      com.feingeist.shimo.helper
  248.  248      com.fitbit.galileod
  249.  249      com.github.GitHub.GHInstallCLI
  250.  250      com.intego.WashingMachine.service
  251.  251      com.intego.commonservices.daemon.integod
  252.  252      com.intego.commonservices.daemon.taskmanager
  253.  253      com.intego.commonservices.icalserver
  254.  254      com.intego.commonservices.metrics.kschecker
  255.  255      com.intego.netupdate.daemon
  256.  256      com.intego.virusbarrier.daemon
  257.  257      com.intego.virusbarrier.daemon.emlparser
  258.  258      com.intego.virusbarrier.daemon.logger
  259.  259      com.intego.virusbarrier.daemon.scanner
  260.  260      com.iobit.AMCDaemon
  261.  261      com.maintain.cocktail.scheduler
  262.  262      com.malwarebytes.MBAMHelperTool
  263.  263      com.microsoft.office.licensing.helper
  264.  264      com.microsoft.office.licensingV2.helper
  265.  265      com.oracle.java.Helper-Tool
  266.  266      com.paragon.NTFS.launch
  267.  267      com.sibersystems.GsRunner-gvantass
  268.  268      -     status: -15
  269.  269      com.soma-zone.LaunchControl.Helper
  270.  270      com.speedtools.scheduleagent
  271.  271      com.splashtop.streamer-daemon
  272.  272      com.splashtop.streamer-srioframebuffer
  273.  273      com.surteesstudios.Bartender.BartenderInstallHelper
  274.  274      com.tunabellysoftware.TGFanHelper
  275.  275      comp.text.tex.distribution.Helper
  276.  276      gs-server
  277.  277      org.cindori.CCAuth
  278.  278      org.gpgtools.gpgmail.uuid-patcher
  279.  279      org.macosforge.xquartz.privileged_startx
  280.  280  
  281.  281  System services disabled
  282.  282  
  283.  283      com.apple.security.FDERecoveryAgent
  284.  284      com.apple.mtmfs
  285.  285  
  286.  286  Login services loaded
  287.  287  
  288.  288      2BUA8C4S2C.com.agilebits.onepassword-osx-helper
  289.  289      at.obdev.LittleSnitchUIAgent
  290.  290      com.Monity.Helper
  291.  291      com.adobe.ARM.UUID
  292.  292      com.amazon.music
  293.  293      com.apple.AirPlayUIAgent
  294.  294      com.apple.AssetCacheLocatorService
  295.  295      com.apple.CallHistoryPluginHelper
  296.  296      com.apple.CallHistorySyncHelper
  297.  297      com.apple.EscrowSecurityAlert
  298.  298      com.apple.Maps.mapspushd
  299.  299      com.apple.Safari.SafeBrowsing.Service
  300.  300      com.apple.SafariCloudHistoryPushAgent
  301.  301      com.apple.SafariNotificationAgent
  302.  302      com.apple.Spotlight
  303.  303      com.apple.akd
  304.  304      com.apple.cdpd
  305.  305      com.apple.cloudd
  306.  306      com.apple.cloudphotosd
  307.  307      com.apple.cmfsyncagent
  308.  308      com.apple.coreservices.appleid.authentication
  309.  309      com.apple.coreservices.uiagent
  310.  310      com.apple.followupd
  311.  311      com.apple.gamed
  312.  312      com.apple.icloud.fmfd
  313.  313      com.apple.iconservices.iconservicesagent
  314.  314      com.apple.pbs
  315.  315      com.apple.printtool.agent
  316.  316      com.apple.recentsd
  317.  317      com.apple.reversetemplated
  318.  318      com.apple.scopedbookmarksagent.xpc
  319.  319      com.apple.soagent
  320.  320      com.apple.spindump_agent
  321.  321      com.apple.spotlight.IndexAgent
  322.  322      com.apple.suggestd
  323.  323      com.apple.swcd
  324.  324      com.apple.telephonyutilities.callservicesd
  325.  325      com.apple.xpc.loginitemregisterd
  326.  326      com.couchpotato.movies
  327.  327      com.dayoneapp.dayone-agent
  328.  328      com.ecamm.iglasses3agent
  329.  329      com.ecamm.printopia
  330.  330      com.eltima.tp2.kicker
  331.  331      com.erikhinterbichler.HeraldLaunchAgent
  332.  332      com.flexibits.fantastical2.mac.launcher
  333.  333      com.globaldelight.Boom2Daemon
  334.  334      com.google.keystone.system.agent
  335.  335      com.growl.HardwareGrowlerLauncher
  336.  336      com.intego.commonservices.integomenu
  337.  337      com.intego.commonservices.taskmanager
  338.  338      com.intego.commonservices.uninstaller
  339.  339      com.intego.netupdate.agent
  340.  340      com.intego.virusbarrier.alert
  341.  341      com.iobit.MacBooster-mini
  342.  342      -     status: 78
  343.  343      com.iobit.iosMonitor
  344.  344      com.junecloud.mac.Deliveries.Launcher
  345.  345      com.littleknownsoftware.MailPluginTool-Startup
  346.  346      com.maintain.PurgeInactiveMemory
  347.  347      -     status: 1
  348.  348      com.maintain.ShowUserLibraryDirectory
  349.  349      com.maintain.SystemEvents
  350.  350      com.oracle.java.Java-Updater
  351.  351      com.paragon-software.NTFS.fsnotifyagent
  352.  352      com.paragon.updater
  353.  353      com.robohippo.HippoConnectAgent
  354.  354      com.sickbeard.tv
  355.  355      com.splashtop.streamer-for-user
  356.  356      com.spotify.webhelper
  357.  357      com.techsmith.snagit.SnagitLaunchAtLogin
  358.  358      com.valvesoftware.steamclean
  359.  359      de.martinlexow.TheineHelperObjC
  360.  360      it.danilotorrisi.command-c-osx-helper
  361.  361      net.culater.SIMBL.Agent
  362.  362      org.gpgtools.Libmacgpg.xpc
  363.  363      org.gpgtools.gpgmail.enable-bundles
  364.  364      org.gpgtools.gpgmail.updater
  365.  365      org.gpgtools.gpgmail.user-uuid-patcher
  366.  366      org.gpgtools.macgpg2.fix
  367.  367      org.gpgtools.macgpg2.shutdown-gpg-agent
  368.  368      org.gpgtools.macgpg2.updater
  369.  369      org.macosforge.xquartz.startx
  370.  370  
  371.  371  Login services disabled
  372.  372  
  373.  373      com.sweetpproductions.DesktopUtilityHelper
  374.  374      com.itsabouttime.pinterestHelper
  375.  375      com.fiplab.NotesTab-Helper
  376.  376      com.microsoft.OneDriveLauncher
  377.  377      com.uglyapps.HocusFocusHelper
  378.  378  
  379.  379  User services loaded
  380.  380  
  381.  381      com.apple.AddressBook.ContactsAccountsService
  382.  382      com.apple.BKAgentService
  383.  383      com.apple.CloudPhotosConfiguration
  384.  384      com.apple.InputMethodKit.TextReplacementService
  385.  385      com.apple.ViewBridgeAuxiliary
  386.  386      com.apple.hiservices-xpcservice
  387.  387      com.apple.iCloudHelper
  388.  388      com.apple.imdpersistence.IMDPersistenceAgent
  389.  389      com.apple.lakitu
  390.  390      com.apple.pluginkit.pkd
  391.  391      com.apple.secinitd
  392.  392      com.apple.security.cloudkeychainproxy3
  393.  393      com.apple.tccd
  394.  394  
  395.  395  User services disabled
  396.  396  
  397.  397      com.sweetpproductions.DesktopUtilityHelper
  398.  398      com.itsabouttime.pinterestHelper
  399.  399      com.fiplab.NotesTab-Helper
  400.  400      com.microsoft.OneDriveLauncher
  401.  401      com.uglyapps.HocusFocusHelper
  402.  402  
  403.  403  Startup items
  404.  404  
  405.  405      /Library/StartupItems/Cocktail/StartupParameters.plist
  406.  406  
  407.  407  Contents of /Library/LaunchAgents/at.obdev.LittleSnitchUIAgent.plist
  408.  408      -     mod date: Sep 26 08:08:25 2015
  409.  409      -     size (B): 464
  410.  410      -     checksum: 2014742307
  411.  411  
  412.  412      <?xml version="1.0" encoding="UTF-8"?>
  413.  413      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  414.  414      <plist version="1.0">
  415.  415      <dict>
  416.  416            <key>KeepAlive</key>
  417.  417            <true/>
  418.  418            <key>Label</key>
  419.  419            <string>at.obdev.LittleSnitchUIAgent</string>
  420.  420            <key>ProgramArguments</key>
  421.  421            <array>
  422.  422                    <string>/Library/Little Snitch/Little Snitch Agent.app/Contents/MacOS/Little Snitch Agent</string>
  423.  423            </array>
  424.  424            <key>RunAtLoad</key>
  425.  425            <true/>
  426.  426      </dict>
  427.  427      </plist>
  428.  428  
  429.  429  Contents of /Library/LaunchAgents/com.Monity.Helper.plist
  430.  430      -     mod date: Aug 12 08:11:03 2015
  431.  431      -     size (B): 450
  432.  432      -     checksum: 891655393
  433.  433  
  434.  434      <?xml version="1.0" encoding="UTF-8"?>
  435.  435      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  436.  436      <plist version="1.0">
  437.  437      <dict>
  438.  438            <key>Label</key>
  439.  439            <string>com.Monity.Helper</string>
  440.  440            <key>ProgramArguments</key>
  441.  441            <array>
  442.  442                    <string>/Library/PrivilegedHelperTools/Monity Helper.app/Contents/MacOS/Monity Helper</string>
  443.  443            </array>
  444.  444            <key>RunAtLoad</key>
  445.  445            <true/>
  446.  446            <key>KeepAlive</key>
  447.  447            <false/>
  448.  448      </dict>
  449.  449      </plist>
  450.  450  
  451.  451  Contents of /Library/LaunchAgents/com.ecamm.iglasses3agent.plist
  452.  452      -     mod date: Sep 19 08:14:08 2015
  453.  453      -     size (B): 483
  454.  454      -     checksum: 4208922684
  455.  455  
  456.  456      <?xml version="1.0" encoding="UTF-8"?>
  457.  457      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  458.  458      <plist version="1.0">
  459.  459      <dict>
  460.  460            <key>KeepAlive</key>
  461.  461            <true/>
  462.  462            <key>Label</key>
  463.  463            <string>com.ecamm.iglasses3agent</string>
  464.  464            <key>LimitLoadToSessionType</key>
  465.  465            <string>Aqua</string>
  466.  466            <key>Program</key>
  467.  467            <string>/Library/Application Support/iGlasses3/iGlasses.app/Contents/MacOS/iGlasses</string>
  468.  468            <key>RunAtLoad</key>
  469.  469            <true/>
  470.  470      </dict>
  471.  471      </plist>
  472.  472  
  473.  473  Contents of /Library/LaunchAgents/com.intego.commonservices.integomenu.plist
  474.  474      -     mod date: Dec 13 09:52:37 2013
  475.  475      -     size (B): 691
  476.  476      -     checksum: 1276779959
  477.  477  
  478.  478      <?xml version="1.0" encoding="UTF-8"?>
  479.  479      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  480.  480      <plist version="1.0">
  481.  481      <dict>
  482.  482            <key>KeepAlive</key>
  483.  483            <dict>
  484.  484                    <key>SuccessfulExit</key>
  485.  485                    <false/>
  486.  486            </dict>
  487.  487            <key>Label</key>
  488.  488            <string>com.intego.commonservices.integomenu</string>
  489.  489            <key>LimitLoadToSessionType</key>
  490.  490            <string>Aqua</string>
  491.  491            <key>ProgramArguments</key>
  492.  492            <array>
  493.  493                    <string>/Library/Intego/commonservices.bundle/Contents/MacOS/IntegoMenu.app/Contents/MacOS/IntegoMenu</string>
  494.  494            </array>
  495.  495            <key>RunAtLoad</key>
  496.  496            <true/>
  497.  497            <key>MachServices</key>
  498.  498            <dict>
  499.  499                    <key>com.intego.commonservices.integomenu</key>
  500.  500                    <true/>
  501.  501            </dict>
  502.  502      </dict>
  503.  503  
  504.  504      ...and 1 more line(s)
  505.  505  
  506.  506  Contents of /Library/LaunchAgents/com.intego.commonservices.taskmanager.plist
  507.  507      -     mod date: Nov 12 09:59:52 2013
  508.  508      -     size (B): 586
  509.  509      -     checksum: 2770223182
  510.  510  
  511.  511      <?xml version="1.0" encoding="UTF-8"?>
  512.  512      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  513.  513      <plist version="1.0">
  514.  514      <dict>
  515.  515            <key>KeepAlive</key>
  516.  516            <false/>
  517.  517            <key>LimitLoadToSessionType</key>
  518.  518            <string>Aqua</string>
  519.  519            <key>WatchPaths</key>
  520.  520            <array>
  521.  521                    <string>/Library/Intego/TaskManager/.start</string>
  522.  522            </array>
  523.  523            <key>Label</key>
  524.  524            <string>com.intego.commonservices.taskmanager</string>
  525.  525            <key>ProgramArguments</key>
  526.  526            <array>
  527.  527                    <string>/Library/Intego/TaskManager/TM_Notifier.app/Contents/MacOS/TM_Notifier</string>
  528.  528            </array>
  529.  529      </dict>
  530.  530      </plist>
  531.  531  
  532.  532  Contents of /Library/LaunchAgents/com.intego.commonservices.uninstaller.plist
  533.  533      -     mod date: Dec  3 22:04:24 2013
  534.  534      -     size (B): 609
  535.  535      -     checksum: 190387482
  536.  536  
  537.  537      <?xml version="1.0" encoding="UTF-8"?>
  538.  538      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  539.  539      <plist version="1.0">
  540.  540      <dict>
  541.  541            <key>KeepAlive</key>
  542.  542            <false/>
  543.  543            <key>LimitLoadToSessionType</key>
  544.  544            <string>Aqua</string>
  545.  545            <key>WatchPaths</key>
  546.  546            <array>
  547.  547                    <string>/Applications/</string>
  548.  548                    <string>/Applications/Intego/</string>
  549.  549            </array>
  550.  550            <key>Label</key>
  551.  551            <string>com.intego.commonservices.uninstaller</string>
  552.  552            <key>ProgramArguments</key>
  553.  553            <array>
  554.  554                    <string>/Library/Intego/Intego Uninstaller.app/Contents/MacOS/Intego Uninstaller</string>
  555.  555            </array>
  556.  556      </dict>
  557.  557      </plist>
  558.  558  
  559.  559  Contents of /Library/LaunchAgents/com.intego.netupdate.agent.plist
  560.  560      -     mod date: Jun 29 08:50:18 2015
  561.  561      -     size (B): 538
  562.  562      -     checksum: 2663754357
  563.  563  
  564.  564      <?xml version="1.0" encoding="UTF-8"?>
  565.  565      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  566.  566      <plist version="1.0">
  567.  567      <dict>
  568.  568            <key>Label</key>
  569.  569            <string>com.intego.netupdate.agent</string>
  570.  570            <key>LimitLoadToSessionType</key>
  571.  571            <array>
  572.  572                    <string>LoginWindow</string>
  573.  573                    <string>Aqua</string>
  574.  574            </array>
  575.  575            <key>KeepAlive</key>
  576.  576            <true/>
  577.  577            <key>ProgramArguments</key>
  578.  578            <array>
  579.  579                    <string>/Library/PrivilegedHelperTools/NetUpdateAgent.app/Contents/MacOS/NetUpdateAgent</string>
  580.  580            </array>
  581.  581      </dict>
  582.  582      </plist>
  583.  583  
  584.  584  Contents of /Library/LaunchAgents/com.intego.virusbarrier.alert.plist
  585.  585      -     mod date: Sep  6 11:38:57 2013
  586.  586      -     size (B): 741
  587.  587      -     checksum: 397299966
  588.  588  
  589.  589      <?xml version="1.0" encoding="UTF-8"?>
  590.  590      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  591.  591      <plist version="1.0">
  592.  592      <dict>
  593.  593            <key>Label</key>
  594.  594            <string>com.intego.virusbarrier.alert</string>
  595.  595            <key>LimitLoadToSessionType</key>
  596.  596            <string>Aqua</string>
  597.  597            <key>RunAtLoad</key>
  598.  598            <true/>
  599.  599            <key>WatchPaths</key>
  600.  600            <array>
  601.  601                    <string>/Library/Intego/virusbarrier.bundle/Contents/Resources/start_alert</string>
  602.  602            </array>
  603.  603            <key>ProgramArguments</key>
  604.  604            <array>
  605.  605                    <string>/Library/Intego/virusbarrier.bundle/Contents/MacOS/VirusBarrier Alert.app/Contents/MacOS/VirusBarrier Alert</string>
  606.  606            </array>
  607.  607            <key>MachServices</key>
  608.  608            <dict>
  609.  609                    <key>com.intego.virusbarrier.alert</key>
  610.  610                    <true/>
  611.  611            </dict>
  612.  612      </dict>
  613.  613      </plist>
  614.  614  
  615.  615  Contents of /Library/LaunchAgents/com.maintain.LogOut.plist
  616.  616      -     mod date: Oct  5 06:35:31 2015
  617.  617      -     size (B): 904
  618.  618      -     checksum: 2486542021
  619.  619  
  620.  620      <?xml version="1.0" encoding="UTF-8"?>
  621.  621      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  622.  622      <plist version="1.0">
  623.  623      <dict>
  624.  624            <key>Disabled</key>
  625.  625            <true/>
  626.  626            <key>Label</key>
  627.  627            <string>com.maintain.LogOut</string>
  628.  628            <key>ProgramArguments</key>
  629.  629            <array>
  630.  630                    <string>/usr/bin/osascript</string>
  631.  631                    <string>-e</string>
  632.  632                    <string>delay 3</string>
  633.  633                    <string>-e</string>
  634.  634                    <string>try</string>
  635.  635                    <string>-e</string>
  636.  636                    <string>do shell script &quot;killall Cocktail&quot;</string>
  637.  637                    <string>-e</string>
  638.  638                    <string>end try</string>
  639.  639                    <string>-e</string>
  640.  640                    <string>ignoring application responses</string>
  641.  641                    <string>-e</string>
  642.  642                    <string>try</string>
  643.  643                    <string>-e</string>
  644.  644                    <string>tell application &quot;System Events&quot; to log out</string>
  645.  645  
  646.  646      ...and 7 more line(s)
  647.  647  
  648.  648  Contents of /Library/LaunchAgents/com.maintain.PurgeInactiveMemory.plist
  649.  649      -     Apple binary property list
  650.  650      -     mod date: Mar  5 04:02:59 2015
  651.  651      -     size (B): 181
  652.  652      -     checksum: 603737813
  653.  653  
  654.  654      Dict {
  655.  655          ProgramArguments = Array {
  656.  656              /usr/sbin/purge
  657.  657          }
  658.  658          StartInterval = 900
  659.  659          Disabled = false
  660.  660          RunAtLoad = false
  661.  661          Label = com.maintain.PurgeInactiveMemory
  662.  662      }
  663.  663  
  664.  664  Contents of /Library/LaunchAgents/com.maintain.Restart.plist
  665.  665      -     mod date: Jan 19 23:17:16 2015
  666.  666      -     size (B): 905
  667.  667      -     checksum: 1856196442
  668.  668  
  669.  669      <?xml version="1.0" encoding="UTF-8"?>
  670.  670      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  671.  671      <plist version="1.0">
  672.  672      <dict>
  673.  673            <key>Disabled</key>
  674.  674            <true/>
  675.  675            <key>Label</key>
  676.  676            <string>com.maintain.Restart</string>
  677.  677            <key>ProgramArguments</key>
  678.  678            <array>
  679.  679                    <string>/usr/bin/osascript</string>
  680.  680                    <string>-e</string>
  681.  681                    <string>delay 3</string>
  682.  682                    <string>-e</string>
  683.  683                    <string>try</string>
  684.  684                    <string>-e</string>
  685.  685                    <string>do shell script &quot;killall Cocktail&quot;</string>
  686.  686                    <string>-e</string>
  687.  687                    <string>end try</string>
  688.  688                    <string>-e</string>
  689.  689                    <string>ignoring application responses</string>
  690.  690                    <string>-e</string>
  691.  691                    <string>try</string>
  692.  692                    <string>-e</string>
  693.  693                    <string>tell application &quot;System Events&quot; to restart</string>
  694.  694  
  695.  695      ...and 7 more line(s)
  696.  696  
  697.  697  Contents of /Library/LaunchAgents/com.maintain.ShutDown.plist
  698.  698      -     mod date: Jan 19 23:17:17 2015
  699.  699      -     size (B): 908
  700.  700      -     checksum: 2131448796
  701.  701  
  702.  702      <?xml version="1.0" encoding="UTF-8"?>
  703.  703      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  704.  704      <plist version="1.0">
  705.  705      <dict>
  706.  706            <key>Disabled</key>
  707.  707            <true/>
  708.  708            <key>Label</key>
  709.  709            <string>com.maintain.ShutDown</string>
  710.  710            <key>ProgramArguments</key>
  711.  711            <array>
  712.  712                    <string>/usr/bin/osascript</string>
  713.  713                    <string>-e</string>
  714.  714                    <string>delay 3</string>
  715.  715                    <string>-e</string>
  716.  716                    <string>try</string>
  717.  717                    <string>-e</string>
  718.  718                    <string>do shell script &quot;killall Cocktail&quot;</string>
  719.  719                    <string>-e</string>
  720.  720                    <string>end try</string>
  721.  721                    <string>-e</string>
  722.  722                    <string>ignoring application responses</string>
  723.  723                    <string>-e</string>
  724.  724                    <string>try</string>
  725.  725                    <string>-e</string>
  726.  726                    <string>tell application &quot;System Events&quot; to shut down</string>
  727.  727  
  728.  728      ...and 7 more line(s)
  729.  729  
  730.  730  Contents of /Library/LaunchAgents/com.maintain.Sleep.plist
  731.  731      -     mod date: Oct  5 06:35:35 2015
  732.  732      -     size (B): 901
  733.  733      -     checksum: 2684026111
  734.  734  
  735.  735      <?xml version="1.0" encoding="UTF-8"?>
  736.  736      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  737.  737      <plist version="1.0">
  738.  738      <dict>
  739.  739            <key>Disabled</key>
  740.  740            <true/>
  741.  741            <key>Label</key>
  742.  742            <string>com.maintain.Sleep</string>
  743.  743            <key>ProgramArguments</key>
  744.  744            <array>
  745.  745                    <string>/usr/bin/osascript</string>
  746.  746                    <string>-e</string>
  747.  747                    <string>delay 3</string>
  748.  748                    <string>-e</string>
  749.  749                    <string>try</string>
  750.  750                    <string>-e</string>
  751.  751                    <string>do shell script &quot;killall Cocktail&quot;</string>
  752.  752                    <string>-e</string>
  753.  753                    <string>end try</string>
  754.  754                    <string>-e</string>
  755.  755                    <string>ignoring application responses</string>
  756.  756                    <string>-e</string>
  757.  757                    <string>try</string>
  758.  758                    <string>-e</string>
  759.  759                    <string>tell application &quot;System Events&quot; to sleep</string>
  760.  760  
  761.  761      ...and 7 more line(s)
  762.  762  
  763.  763  Contents of /Library/LaunchAgents/com.maintain.SystemEvents.plist
  764.  764      -     mod date: Jan 19 23:17:17 2015
  765.  765      -     size (B): 486
  766.  766      -     checksum: 1297325733
  767.  767  
  768.  768      <?xml version="1.0" encoding="UTF-8"?>
  769.  769      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  770.  770      <plist version="1.0">
  771.  771      <dict>
  772.  772            <key>Disabled</key>
  773.  773            <false/>
  774.  774            <key>KeepAlive</key>
  775.  775            <true/>
  776.  776            <key>Label</key>
  777.  777            <string>com.maintain.SystemEvents</string>
  778.  778            <key>ProgramArguments</key>
  779.  779            <array>
  780.  780                    <string>/System/Library/CoreServices/System Events.app/Contents/MacOS/System Events</string>
  781.  781            </array>
  782.  782            <key>RunAtLoad</key>
  783.  783            <true/>
  784.  784      </dict>
  785.  785      </plist>
  786.  786  
  787.  787  Contents of /Library/LaunchAgents/com.oracle.java.Java-Updater.plist
  788.  788      -     mod date: Aug 27 00:29:15 2015
  789.  789      -     size (B): 104
  790.  790      -     checksum: 2656802019
  791.  791  
  792.  792      <?xml version="1.0" encoding="UTF-8"?>
  793.  793      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  794.  794      <plist version="1.0">
  795.  795      <dict>
  796.  796            <key>Label</key>
  797.  797            <string>com.oracle.java.Java-Updater</string>
  798.  798            <key>ProgramArguments</key>
  799.  799            <array>
  800.  800                    <string>/Library/Internet Plug-Ins/JavaAppletPlugin.plugin/Contents/Resources/Java Updater.app/Contents/MacOS/Java Updater</string>
  801.  801                    <string>-bgcheck</string>
  802.  802            </array>
  803.  803            <key>StandardErrorPath</key>
  804.  804            <string>/dev/null</string>
  805.  805            <key>StandardOutPath</key>
  806.  806            <string>/dev/null</string>
  807.  807            <key>StartCalendarInterval</key>
  808.  808            <dict>
  809.  809                    <key>Hour</key>
  810.  810                    <integer>4</integer>
  811.  811                    <key>Minute</key>
  812.  812                    <integer>58</integer>
  813.  813                    <key>Weekday</key>
  814.  814                    <integer>4</integer>
  815.  815            </dict>
  816.  816      </dict>
  817.  817  
  818.  818      ...and 1 more line(s)
  819.  819  
  820.  820  Contents of /Library/LaunchAgents/com.paragon-software.NTFS.fsnotifyagent.plist
  821.  821      -     mod date: Oct 23 05:56:00 2015
  822.  822      -     size (B): 534
  823.  823      -     checksum: 2618589534
  824.  824  
  825.  825      <?xml version="1.0" encoding="UTF-8"?>
  826.  826      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  827.  827      <plist version="1.0">
  828.  828      <dict>
  829.  829            <key>Label</key>
  830.  830            <string>com.paragon-software.NTFS.fsnotifyagent</string>
  831.  831            <key>Program</key>
  832.  832            <string>/Library/PreferencePanes/ParagonNTFS.prefPane/Contents/Resources/fsnotifyagent.app/Contents/MacOS/fsnotifyagent</string>
  833.  833            <key>RunAtLoad</key>
  834.  834            <true/>
  835.  835            <key>KeepAlive</key>
  836.  836            <true/>
  837.  837            <key>LimitLoadToSessionType</key>
  838.  838            <string>Aqua</string>
  839.  839      </dict>
  840.  840      </plist>
  841.  841  
  842.  842  Contents of /Library/LaunchAgents/com.paragon.updater.plist
  843.  843      -     mod date: Oct 23 05:55:52 2015
  844.  844      -     size (B): 548
  845.  845      -     checksum: 962844124
  846.  846  
  847.  847      <?xml version="1.0" encoding="UTF-8"?>
  848.  848      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  849.  849      <plist version="1.0">
  850.  850      <dict>
  851.  851            <key>StartInterval</key>
  852.  852                    <integer>86400</integer>
  853.  853            <key>ProgramArguments</key>
  854.  854            <array>
  855.  855                    <string>/Library/Application Support/Paragon Updater/Paragon Updater.app/Contents/MacOS/Paragon Updater</string>
  856.  856                    <string>--check</string>
  857.  857                    <string>--delay=30</string>
  858.  858            </array>
  859.  859            <key>Label</key>
  860.  860            <string>com.paragon.updater</string>
  861.  861            <key>RunAtLoad</key>
  862.  862            <true/>
  863.  863      </dict>
  864.  864      </plist>
  865.  865  
  866.  866  Contents of /Library/LaunchAgents/com.robohippo.HippoConnectAgent.plist
  867.  867      -     mod date: Jan  7 01:36:51 2014
  868.  868      -     size (B): 692
  869.  869      -     checksum: 440542358
  870.  870  
  871.  871      <?xml version="1.0" encoding="UTF-8"?>
  872.  872      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  873.  873      <plist version="1.0">
  874.  874      <dict>
  875.  875            <key>GroupName</key>
  876.  876            <string>wheel</string>
  877.  877            <key>KeepAlive</key>
  878.  878            <true/>
  879.  879            <key>Label</key>
  880.  880            <string>com.robohippo.HippoConnectAgent</string>
  881.  881            <key>LimitLoadToSessionType</key>
  882.  882            <array>
  883.  883                    <string>Aqua</string>
  884.  884            </array>
  885.  885            <key>OnDemand</key>
  886.  886            <false/>
  887.  887            <key>ProgramArguments</key>
  888.  888            <array>
  889.  889                    <string>/Library/Application Support/HippoConnect/HippoConnectAgent</string>
  890.  890                    <string>-p</string>
  891.  891                    <string>c0nn0r</string>
  892.  892            </array>
  893.  893            <key>RunAtLoad</key>
  894.  894            <true/>
  895.  895            <key>UserName</key>
  896.  896  
  897.  897      ...and 3 more line(s)
  898.  898  
  899.  899  Contents of /Library/LaunchAgents/com.splashtop.streamer-for-root.plist
  900.  900      -     mod date: Sep 23 04:16:29 2015
  901.  901      -     size (B): 664
  902.  902      -     checksum: 2759554987
  903.  903  
  904.  904      <?xml version="1.0" encoding="UTF-8"?>
  905.  905      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  906.  906      <plist version="1.0">
  907.  907      <dict>
  908.  908            <key>Label</key>
  909.  909            <string>com.splashtop.streamer-for-root</string>
  910.  910            <key>LimitLoadToSessionType</key>
  911.  911            <array>
  912.  912                    <string>LoginWindow</string>
  913.  913            </array>
  914.  914            <key>KeepAlive</key>
  915.  915            <dict>
  916.  916                    <key>SuccessfulExit</key>
  917.  917                    <false/>
  918.  918                    <key>AfterInitialDemand</key>
  919.  919                    <false/>
  920.  920            </dict>
  921.  921            <key>RunAtLoad</key>
  922.  922            <true/>
  923.  923            <key>ProgramArguments</key>
  924.  924            <array>
  925.  925                    <string>/Applications/Splashtop Streamer.app/Contents/MacOS/Splashtop Streamer</string>
  926.  926                    <string>RunAtPreLogin</string>
  927.  927            </array>
  928.  928      </dict>
  929.  929  
  930.  930      ...and 1 more line(s)
  931.  931  
  932.  932  Contents of /Library/LaunchAgents/com.splashtop.streamer-for-user.plist
  933.  933      -     mod date: Sep 23 04:16:29 2015
  934.  934      -     size (B): 654
  935.  935      -     checksum: 522106556
  936.  936  
  937.  937      <?xml version="1.0" encoding="UTF-8"?>
  938.  938      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  939.  939      <plist version="1.0">
  940.  940      <dict>
  941.  941            <key>Label</key>
  942.  942            <string>com.splashtop.streamer-for-user</string>
  943.  943            <key>LimitLoadToSessionType</key>
  944.  944            <array>
  945.  945                    <string>Aqua</string>
  946.  946            </array>
  947.  947            <key>KeepAlive</key>
  948.  948            <dict>
  949.  949                    <key>SuccessfulExit</key>
  950.  950                    <false/>
  951.  951                    <key>AfterInitialDemand</key>
  952.  952                    <false/>
  953.  953            </dict>
  954.  954            <key>RunAtLoad</key>
  955.  955            <true/>
  956.  956            <key>ProgramArguments</key>
  957.  957            <array>
  958.  958                    <string>/Applications/Splashtop Streamer.app/Contents/MacOS/Splashtop Streamer</string>
  959.  959                    <string>RunAtLogin</string>
  960.  960            </array>
  961.  961      </dict>
  962.  962  
  963.  963      ...and 1 more line(s)
  964.  964  
  965.  965  Contents of /Library/LaunchAgents/org.gpgtools.Libmacgpg.xpc.plist
  966.  966      -     mod date: Sep 23 12:46:49 2015
  967.  967      -     size (B): 556
  968.  968      -     checksum: 2633516353
  969.  969  
  970.  970      <?xml version="1.0" encoding="UTF-8"?>
  971.  971      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  972.  972      <plist version="1.0">
  973.  973      <dict>
  974.  974            <key>EnableTransactions</key>
  975.  975            <true/>
  976.  976            <key>KeepAlive</key>
  977.  977            <false/>
  978.  978            <key>Label</key>
  979.  979            <string>org.gpgtools.Libmacgpg.xpc</string>
  980.  980            <key>MachServices</key>
  981.  981            <dict>
  982.  982                    <key>org.gpgtools.Libmacgpg.xpc_OpenStep</key>
  983.  983                    <true/>
  984.  984            </dict>
  985.  985            <key>ProgramArguments</key>
  986.  986            <array>
  987.  987                    <string>/Library/Application Support/GPGTools/org.gpgtools.Libmacgpg.xpc</string>
  988.  988            </array>
  989.  989      </dict>
  990.  990      </plist>
  991.  991  
  992.  992  Contents of /Library/LaunchAgents/org.gpgtools.gpgmail.enable-bundles.plist
  993.  993      -     mod date: Mar  8 08:03:00 2015
  994.  994      -     size (B): 478
  995.  995      -     checksum: 4256729205
  996.  996  
  997.  997      <?xml version="1.0" encoding="UTF-8"?>
  998.  998      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  999.  999      <plist version="1.0">
  1000. 1000      <dict>
  1001. 1001            <key>Label</key>
  1002. 1002            <string>org.gpgtools.gpgmail.enable-bundles</string>
  1003. 1003            <key>ProgramArguments</key>
  1004. 1004            <array>
  1005. 1005              <string>/Library/Application Support/GPGTools/uuid-patcher</string>
  1006. 1006              <string>enable-bundles</string>
  1007. 1007        </array>
  1008. 1008            <key>RunAtLoad</key>
  1009. 1009            <true/>
  1010. 1010            <key>KeepAlive</key>
  1011. 1011            <false/>
  1012. 1012      </dict>
  1013. 1013      </plist>
  1014. 1014  
  1015. 1015  Contents of /Library/LaunchAgents/org.gpgtools.gpgmail.patch-uuid-user.plist
  1016. 1016      -     mod date: Mar  8 08:03:00 2015
  1017. 1017      -     size (B): 415
  1018. 1018      -     checksum: 2367346596
  1019. 1019  
  1020. 1020      <?xml version="1.0" encoding="UTF-8"?>
  1021. 1021      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1022. 1022      <plist version="1.0">
  1023. 1023      <dict>
  1024. 1024            <key>Label</key>
  1025. 1025            <string>org.gpgtools.gpgmail.user-uuid-patcher</string>
  1026. 1026            <key>Program</key>
  1027. 1027            <string>/Library/Application Support/GPGTools/uuid-patcher</string>
  1028. 1028            <key>RunAtLoad</key>
  1029. 1029            <true/>
  1030. 1030            <key>KeepAlive</key>
  1031. 1031            <false/>
  1032. 1032      </dict>
  1033. 1033      </plist>
  1034. 1034  
  1035. 1035  Contents of /Library/LaunchAgents/org.gpgtools.gpgmail.updater.plist
  1036. 1036      -     mod date: Sep 23 11:00:35 2015
  1037. 1037      -     size (B): 493
  1038. 1038      -     checksum: 2804634747
  1039. 1039  
  1040. 1040      <?xml version="1.0" encoding="UTF-8"?>
  1041. 1041      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1042. 1042      <plist version="1.0">
  1043. 1043      <dict>
  1044. 1044            <key>KeepAlive</key>
  1045. 1045            <false/>
  1046. 1046            <key>StartInterval</key>
  1047. 1047            <integer>10800</integer>
  1048. 1048            <key>Label</key>
  1049. 1049            <string>org.gpgtools.gpgmail.updater</string>
  1050. 1050            <key>ProgramArguments</key>
  1051. 1051            <array>
  1052. 1052                    <string>/Library/Application Support/GPGTools/GPGMail_Updater.app/Contents/MacOS/GPGMail_Updater</string>
  1053. 1053            </array>
  1054. 1054      </dict>
  1055. 1055      </plist>
  1056. 1056  
  1057. 1057  Contents of /Library/LaunchAgents/org.gpgtools.macgpg2.fix.plist
  1058. 1058      -     mod date: Mar  8 08:03:00 2015
  1059. 1059      -     size (B): 417
  1060. 1060      -     checksum: 3267088882
  1061. 1061  
  1062. 1062      <?xml version="1.0" encoding="UTF-8"?>
  1063. 1063      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1064. 1064      <plist version="1.0">
  1065. 1065      <dict>
  1066. 1066            <key>KeepAlive</key>
  1067. 1067            <false/>
  1068. 1068            <key>Label</key>
  1069. 1069            <string>org.gpgtools.macgpg2.fix</string>
  1070. 1070            <key>ProgramArguments</key>
  1071. 1071            <array>
  1072. 1072                    <string>/usr/local/MacGPG2/libexec/fixGpgHome</string>
  1073. 1073            </array>
  1074. 1074            <key>RunAtLoad</key>
  1075. 1075            <true/>
  1076. 1076      </dict>
  1077. 1077      </plist>
  1078. 1078  
  1079. 1079  Contents of /Library/LaunchAgents/org.gpgtools.macgpg2.shutdown-gpg-agent.plist
  1080. 1080      -     mod date: Mar  8 08:03:00 2015
  1081. 1081      -     size (B): 552
  1082. 1082      -     checksum: 3222670079
  1083. 1083  
  1084. 1084      <?xml version="1.0" encoding="UTF-8"?>
  1085. 1085      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1086. 1086      <plist version="1.0">
  1087. 1087        <dict>
  1088. 1088          <key>Label</key>
  1089. 1089          <string>org.gpgtools.macgpg2.shutdown-gpg-agent</string>
  1090. 1090          <key>Program</key>
  1091. 1091          <string>/usr/local/MacGPG2/libexec/shutdown-gpg-agent</string>
  1092. 1092          <key>RunAtLoad</key>
  1093. 1093          <true/>
  1094. 1094          <key>KeepAlive</key>
  1095. 1095          <dict>
  1096. 1096            <key>SuccessfulExit</key>
  1097. 1097            <true/>
  1098. 1098          </dict>
  1099. 1099          <key>ExitTimeOut</key>
  1100. 1100          <integer>5</integer>
  1101. 1101        </dict>
  1102. 1102      </plist>
  1103. 1103  
  1104. 1104  Contents of /Library/LaunchAgents/org.gpgtools.macgpg2.updater.plist
  1105. 1105      -     mod date: Mar  8 08:03:00 2015
  1106. 1106      -     size (B): 482
  1107. 1107      -     checksum: 1275281879
  1108. 1108  
  1109. 1109      <?xml version="1.0" encoding="UTF-8"?>
  1110. 1110      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1111. 1111      <plist version="1.0">
  1112. 1112      <dict>
  1113. 1113            <key>KeepAlive</key>
  1114. 1114            <false/>
  1115. 1115            <key>StartInterval</key>
  1116. 1116            <integer>10800</integer>
  1117. 1117            <key>Label</key>
  1118. 1118            <string>org.gpgtools.macgpg2.updater</string>
  1119. 1119            <key>ProgramArguments</key>
  1120. 1120            <array>
  1121. 1121                    <string>/usr/local/MacGPG2/libexec/MacGPG2_Updater.app/Contents/MacOS/MacGPG2_Updater</string>
  1122. 1122            </array>
  1123. 1123      </dict>
  1124. 1124      </plist>
  1125. 1125  
  1126. 1126  Contents of /Library/LaunchDaemons/at.obdev.littlesnitchd.plist
  1127. 1127      -     mod date: Sep 26 08:08:23 2015
  1128. 1128      -     size (B): 631
  1129. 1129      -     checksum: 4174275850
  1130. 1130  
  1131. 1131      <?xml version="1.0" encoding="UTF-8"?>
  1132. 1132      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1133. 1133      <plist version="1.0">
  1134. 1134      <dict>
  1135. 1135            <key>KeepAlive</key>
  1136. 1136            <true/>
  1137. 1137            <key>Label</key>
  1138. 1138            <string>at.obdev.littlesnitchd</string>
  1139. 1139            <key>ProgramArguments</key>
  1140. 1140            <array>
  1141. 1141                    <string>/Library/Little Snitch/Little Snitch Daemon.bundle/Contents/MacOS/Little Snitch Daemon</string>
  1142. 1142            </array>
  1143. 1143            <key>RunAtLoad</key>
  1144. 1144            <true/>
  1145. 1145            <key>StandardErrorPath</key>
  1146. 1146            <string>/Library/Logs/LittleSnitchDaemon.log</string>
  1147. 1147            <key>StandardOutPath</key>
  1148. 1148            <string>/Library/Logs/LittleSnitchDaemon.log</string>
  1149. 1149      </dict>
  1150. 1150      </plist>
  1151. 1151  
  1152. 1152  Contents of /Library/LaunchDaemons/com.ambrosiasw.ambrosiaaudiosupporthelper.daemon.plist
  1153. 1153      -     mod date: Jan  4 14:03:17 2013
  1154. 1154      -     size (B): 780
  1155. 1155      -     checksum: 1980407752
  1156. 1156  
  1157. 1157      <?xml version="1.0" encoding="UTF-8"?>
  1158. 1158      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1159. 1159      <plist version="1.0">
  1160. 1160      <dict>
  1161. 1161            <key>Label</key>
  1162. 1162            <string>com.ambrosiasw.ambrosiaaudiosupporthelper.daemon</string>
  1163. 1163            <key>ProgramArguments</key>
  1164. 1164            <array>
  1165. 1165                    <string>/System/Library/Extensions/AmbrosiaAudioSupport.kext/Contents/MacOS/ambrosiaaudiosupporthelper</string>
  1166. 1166            </array>
  1167. 1167            <key>KeepAlive</key>
  1168. 1168            <false/>
  1169. 1169            <key>Disabled</key>
  1170. 1170            <false/>
  1171. 1171            <key>LaunchEvents</key>
  1172. 1172            <dict>
  1173. 1173                    <key>com.apple.iokit.matching</key>
  1174. 1174                    <dict>
  1175. 1175                            <key>AmbrosiaAudioSupport</key>
  1176. 1176                            <dict>
  1177. 1177                                    <key>IOMatchLaunchStream</key>
  1178. 1178                                    <true/>
  1179. 1179                                    <key>IOProviderClass</key>
  1180. 1180                                    <string>com_AmbrosiaSW_AudioSupport</string>
  1181. 1181                            </dict>
  1182. 1182  
  1183. 1183      ...and 4 more line(s)
  1184. 1184  
  1185. 1185  Contents of /Library/LaunchDaemons/com.bresink.system.securityagent3a.plist
  1186. 1186      -     mod date: Feb 14 01:51:09 2014
  1187. 1187      -     size (B): 725
  1188. 1188      -     checksum: 1758205685
  1189. 1189  
  1190. 1190      <?xml version="1.0" encoding="UTF-8"?>
  1191. 1191      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1192. 1192      <plist version="1.0">
  1193. 1193      <dict>
  1194. 1194            <key>Label</key>
  1195. 1195            <string>com.bresink.system.securityagent3a</string>
  1196. 1196            <key>ProgramArguments</key>
  1197. 1197            <array>
  1198. 1198                    <string>/Library/PrivilegedHelperTools/com.bresink.system.securityagent3a</string>
  1199. 1199            </array>
  1200. 1200            <key>Sockets</key>
  1201. 1201            <dict>
  1202. 1202                    <key>MasterSocket</key>
  1203. 1203                    <dict>
  1204. 1204                            <key>SockFamily</key>
  1205. 1205                            <string>Unix</string>
  1206. 1206                            <key>SockPathMode</key>
  1207. 1207                            <integer>438</integer>
  1208. 1208                            <key>SockPathName</key>
  1209. 1209                            <string>/var/run/com.bresink.system.securityagent3a.socket</string>
  1210. 1210                            <key>SockType</key>
  1211. 1211                            <string>Stream</string>
  1212. 1212                    </dict>
  1213. 1213            </dict>
  1214. 1214      </dict>
  1215. 1215  
  1216. 1216      ...and 1 more line(s)
  1217. 1217  
  1218. 1218  Contents of /Library/LaunchDaemons/com.chungwasoft.shimo.helper.plist
  1219. 1219      -     mod date: Aug  6 21:46:45 2015
  1220. 1220      -     size (B): 572
  1221. 1221      -     checksum: 1712907597
  1222. 1222  
  1223. 1223      <?xml version="1.0" encoding="UTF-8"?>
  1224. 1224      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1225. 1225      <plist version="1.0">
  1226. 1226      <dict>
  1227. 1227            <key>Label</key>
  1228. 1228            <string>com.chungwasoft.shimo.helper</string>
  1229. 1229            <key>MachServices</key>
  1230. 1230            <dict>
  1231. 1231                    <key>com.chungwasoft.shimo.helper</key>
  1232. 1232                    <true/>
  1233. 1233            </dict>
  1234. 1234            <key>Program</key>
  1235. 1235            <string>/Library/PrivilegedHelperTools/com.chungwasoft.shimo.helper</string>
  1236. 1236            <key>ProgramArguments</key>
  1237. 1237            <array>
  1238. 1238                    <string>/Library/PrivilegedHelperTools/com.chungwasoft.shimo.helper</string>
  1239. 1239            </array>
  1240. 1240      </dict>
  1241. 1241      </plist>
  1242. 1242  
  1243. 1243  Contents of /Library/LaunchDaemons/com.disconnect.networklistener.plist
  1244. 1244      -     mod date: Jun 22 13:36:03 2015
  1245. 1245      -     size (B): 473
  1246. 1246      -     checksum: 3599400854
  1247. 1247  
  1248. 1248      <?xml version="1.0" encoding="UTF-8"?>
  1249. 1249      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1250. 1250      <plist version="1.0">
  1251. 1251      <dict>
  1252. 1252       <key>Label</key>
  1253. 1253       <string>com.disconnect.networklistener</string>
  1254. 1254       <key>ProgramArguments</key>
  1255. 1255       <array>
  1256. 1256       <string>/Library/Application Support/disconnect/changednetwork.sh</string>
  1257. 1257       </array>
  1258. 1258       <key>WatchPaths</key>
  1259. 1259       <array>
  1260. 1260       <string>/private/var/db/dhcpclient/leases/</string>
  1261. 1261       </array>
  1262. 1262      </dict>
  1263. 1263      </plist>
  1264. 1264  
  1265. 1265  Contents of /Library/LaunchDaemons/com.edovia.screensconnect.daemon.plist
  1266. 1266      -     mod date: Sep  5 07:31:26 2013
  1267. 1267      -     size (B): 689
  1268. 1268      -     checksum: 4154779426
  1269. 1269  
  1270. 1270      <?xml version="1.0" encoding="UTF-8"?>
  1271. 1271      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1272. 1272      <plist version="1.0">
  1273. 1273      <dict>
  1274. 1274            <key>Label</key>
  1275. 1275            <string>com.edovia.screensconnect.daemon</string>
  1276. 1276            <key>Disabled</key>
  1277. 1277            <false/>
  1278. 1278            <key>UserName</key>
  1279. 1279            <string>root</string>
  1280. 1280            <key>GroupName</key>
  1281. 1281            <string>wheel</string>
  1282. 1282            <key>Program</key>
  1283. 1283            <string>/Library/PrivilegedHelperTools/screens_connectd</string>
  1284. 1284            <key>RunAtLoad</key>
  1285. 1285            <true/>
  1286. 1286            <key>KeepAlive</key>
  1287. 1287            <dict>
  1288. 1288                    <key>SuccessfulExit</key>
  1289. 1289                    <true/>
  1290. 1290                    <key>PathState</key>
  1291. 1291                    <dict>
  1292. 1292                            <key>/Library/PreferencePanes/Screens Connect.prefPane</key>
  1293. 1293                            <true/>
  1294. 1294                    </dict>
  1295. 1295  
  1296. 1296      ...and 3 more line(s)
  1297. 1297  
  1298. 1298  Contents of /Library/LaunchDaemons/com.eltima.ElmediaPlayer.daemon.plist
  1299. 1299      -     mod date: Apr 23 17:41:13 2013
  1300. 1300      -     size (B): 537
  1301. 1301      -     checksum: 1274124936
  1302. 1302  
  1303. 1303      <?xml version="1.0" encoding="UTF-8"?>
  1304. 1304      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1305. 1305      <plist version="1.0">
  1306. 1306      <dict>
  1307. 1307            <key>Disabled</key>
  1308. 1308            <false/>
  1309. 1309            <key>KeepAlive</key>
  1310. 1310            <false/>
  1311. 1311            <key>Label</key>
  1312. 1312            <string>com.eltima.ElmediaPlayer.daemon</string>
  1313. 1313            <key>LaunchOnlyOnce</key>
  1314. 1314            <true/>
  1315. 1315            <key>OnDemand</key>
  1316. 1316            <false/>
  1317. 1317            <key>ProgramArguments</key>
  1318. 1318            <array>
  1319. 1319                    <string>/Library/Application Support/ElmediaPlayer/empdaemon</string>
  1320. 1320            </array>
  1321. 1321            <key>RunAtLoad</key>
  1322. 1322            <true/>
  1323. 1323      </dict>
  1324. 1324      </plist>
  1325. 1325  
  1326. 1326  Contents of /Library/LaunchDaemons/com.feingeist.shimo.helper.plist
  1327. 1327      -     mod date: Oct 22 16:41:30 2015
  1328. 1328      -     size (B): 564
  1329. 1329      -     checksum: 929791203
  1330. 1330  
  1331. 1331      <?xml version="1.0" encoding="UTF-8"?>
  1332. 1332      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1333. 1333      <plist version="1.0">
  1334. 1334      <dict>
  1335. 1335            <key>Label</key>
  1336. 1336            <string>com.feingeist.shimo.helper</string>
  1337. 1337            <key>MachServices</key>
  1338. 1338            <dict>
  1339. 1339                    <key>com.feingeist.shimo.helper</key>
  1340. 1340                    <true/>
  1341. 1341            </dict>
  1342. 1342            <key>Program</key>
  1343. 1343            <string>/Library/PrivilegedHelperTools/com.feingeist.shimo.helper</string>
  1344. 1344            <key>ProgramArguments</key>
  1345. 1345            <array>
  1346. 1346                    <string>/Library/PrivilegedHelperTools/com.feingeist.shimo.helper</string>
  1347. 1347            </array>
  1348. 1348      </dict>
  1349. 1349      </plist>
  1350. 1350  
  1351. 1351  Contents of /Library/LaunchDaemons/com.fitbit.galileod.plist
  1352. 1352      -     mod date: Dec 30 21:48:16 2014
  1353. 1353      -     size (B): 1169
  1354. 1354      -     checksum: 1302035971
  1355. 1355  
  1356. 1356      <?xml version="1.0" encoding="UTF-8"?>
  1357. 1357      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1358. 1358      <plist version="1.0">
  1359. 1359      <dict>
  1360. 1360            <key>Debug</key>
  1361. 1361            <false/>
  1362. 1362            <key>Disabled</key>
  1363. 1363            <false/>
  1364. 1364            <key>ExitTimeOut</key>
  1365. 1365            <integer>5</integer>
  1366. 1366            <key>GroupName</key>
  1367. 1367            <string>daemon</string>
  1368. 1368            <key>InitGroups</key>
  1369. 1369            <true/>
  1370. 1370            <key>Label</key>
  1371. 1371            <string>com.fitbit.galileod</string>
  1372. 1372            <key>OnDemand</key>
  1373. 1373            <false/>
  1374. 1374            <key>Program</key>
  1375. 1375            <string>/usr/local/bin/galileod</string>
  1376. 1376            <key>ProgramArguments</key>
  1377. 1377            <array>
  1378. 1378                    <string>/usr/local/bin/galileod/disable</string>
  1379. 1379            </array>
  1380. 1380            <key>RunAtLoad</key>
  1381. 1381  
  1382. 1382      ...and 27 more line(s)
  1383. 1383  
  1384. 1384  Contents of /Library/LaunchDaemons/com.github.GitHub.GHInstallCLI.plist
  1385. 1385      -     mod date: Nov  6 19:44:19 2014
  1386. 1386      -     size (B): 612
  1387. 1387      -     checksum: 796956247
  1388. 1388  
  1389. 1389      <?xml version="1.0" encoding="UTF-8"?>
  1390. 1390      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1391. 1391      <plist version="1.0">
  1392. 1392      <dict>
  1393. 1393            <key>KeepAlive</key>
  1394. 1394            <false/>
  1395. 1395            <key>Label</key>
  1396. 1396            <string>com.github.GitHub.GHInstallCLI</string>
  1397. 1397            <key>MachServices</key>
  1398. 1398            <dict>
  1399. 1399                    <key>com.github.GitHub.GHInstallCLI</key>
  1400. 1400                    <true/>
  1401. 1401            </dict>
  1402. 1402            <key>Program</key>
  1403. 1403            <string>/Library/PrivilegedHelperTools/com.github.GitHub.GHInstallCLI</string>
  1404. 1404            <key>ProgramArguments</key>
  1405. 1405            <array>
  1406. 1406                    <string>/Library/PrivilegedHelperTools/com.github.GitHub.GHInstallCLI</string>
  1407. 1407            </array>
  1408. 1408      </dict>
  1409. 1409      </plist>
  1410. 1410  
  1411. 1411  Contents of /Library/LaunchDaemons/com.intego.WashingMachine.service.plist
  1412. 1412      -     mod date: Jan 21 08:40:48 2014
  1413. 1413      -     size (B): 520
  1414. 1414      -     checksum: 3328159078
  1415. 1415  
  1416. 1416      <?xml version="1.0" encoding="UTF-8"?>
  1417. 1417      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1418. 1418      <plist version="1.0">
  1419. 1419      <dict>
  1420. 1420            <key>Label</key>
  1421. 1421            <string>com.intego.WashingMachine.service</string>
  1422. 1422            <key>KeepAlive</key>
  1423. 1423            <true/>
  1424. 1424            <key>MachServices</key>
  1425. 1425            <dict>
  1426. 1426                    <key>com.intego.WashingMachine.service</key>
  1427. 1427                    <true/>
  1428. 1428            </dict>
  1429. 1429            <key>ProgramArguments</key>
  1430. 1430            <array>
  1431. 1431                    <string>/Library/PrivilegedHelperTools/com.intego.WashingMachine.service</string>
  1432. 1432            </array>
  1433. 1433      </dict>
  1434. 1434      </plist>
  1435. 1435  
  1436. 1436  Contents of /Library/LaunchDaemons/com.intego.commonservices.daemon.integod.plist
  1437. 1437      -     mod date: Nov 12 09:59:52 2013
  1438. 1438      -     size (B): 418
  1439. 1439      -     checksum: 3331282155
  1440. 1440  
  1441. 1441      <?xml version="1.0" encoding="UTF-8"?>
  1442. 1442      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1443. 1443      <plist version="1.0">
  1444. 1444      <dict>
  1445. 1445            <key>Label</key>
  1446. 1446            <string>com.intego.commonservices.daemon.integod</string>
  1447. 1447            <key>RunAtLoad</key>
  1448. 1448            <true/>
  1449. 1449            <key>KeepAlive</key>
  1450. 1450            <true/>
  1451. 1451            <key>ProgramArguments</key>
  1452. 1452            <array>
  1453. 1453                    <string>/Library/Intego/integod</string>
  1454. 1454            </array>
  1455. 1455      </dict>
  1456. 1456      </plist>
  1457. 1457  
  1458. 1458  Contents of /Library/LaunchDaemons/com.intego.commonservices.daemon.taskmanager.plist
  1459. 1459      -     mod date: Nov 12 09:59:52 2013
  1460. 1460      -     size (B): 444
  1461. 1461      -     checksum: 2890455724
  1462. 1462  
  1463. 1463      <?xml version="1.0" encoding="UTF-8"?>
  1464. 1464      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1465. 1465      <plist version="1.0">
  1466. 1466      <dict>
  1467. 1467            <key>Label</key>
  1468. 1468            <string>com.intego.commonservices.daemon.taskmanager</string>
  1469. 1469            <key>RunAtLoad</key>
  1470. 1470            <true/>
  1471. 1471            <key>KeepAlive</key>
  1472. 1472            <true/>
  1473. 1473            <key>ProgramArguments</key>
  1474. 1474            <array>
  1475. 1475                    <string>/Library/Intego/TaskManager/TaskManagerDaemon</string>
  1476. 1476            </array>
  1477. 1477      </dict>
  1478. 1478      </plist>
  1479. 1479  
  1480. 1480  Contents of /Library/LaunchDaemons/com.intego.commonservices.icalserver.plist
  1481. 1481      -     mod date: Nov 12 09:59:52 2013
  1482. 1482      -     size (B): 635
  1483. 1483      -     checksum: 1036205248
  1484. 1484  
  1485. 1485      <?xml version="1.0" encoding="UTF-8"?>
  1486. 1486      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1487. 1487      <plist version="1.0">
  1488. 1488      <dict>
  1489. 1489            <key>ServiceIPC</key>
  1490. 1490            <true/>
  1491. 1491            <key>Label</key>
  1492. 1492            <string>com.intego.commonservices.icalserver</string>
  1493. 1493            <key>Sockets</key>
  1494. 1494            <dict>
  1495. 1495                    <key>Listeners</key>
  1496. 1496                    <dict>
  1497. 1497                            <key>SockNodeName</key>
  1498. 1498                            <string>127.0.0.1</string>
  1499. 1499                            <key>SockServiceName</key>
  1500. 1500                            <string>47807</string>
  1501. 1501                            <key>SockFamily</key>
  1502. 1502                            <string>IPv4</string>
  1503. 1503                    </dict>
  1504. 1504            </dict>
  1505. 1505            <key>ProgramArguments</key>
  1506. 1506            <array>
  1507. 1507                    <string>/Library/Intego/IntegoiCalServer</string>
  1508. 1508            </array>
  1509. 1509      </dict>
  1510. 1510  
  1511. 1511      ...and 1 more line(s)
  1512. 1512  
  1513. 1513  Contents of /Library/LaunchDaemons/com.intego.commonservices.metrics.kschecker.plist
  1514. 1514      -     mod date: Nov 12 10:01:09 2013
  1515. 1515      -     size (B): 416
  1516. 1516      -     checksum: 500882172
  1517. 1517  
  1518. 1518      <?xml version="1.0" encoding="UTF-8"?>
  1519. 1519      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1520. 1520      <plist version="1.0">
  1521. 1521      <dict>
  1522. 1522            <key>Label</key>
  1523. 1523            <string>com.intego.commonservices.metrics.kschecker</string>
  1524. 1524            <key>Program</key>
  1525. 1525            <string>/Library/Intego/im_ks_tool</string>
  1526. 1526            <key>RunAtLoad</key>
  1527. 1527            <true/>
  1528. 1528            <key>StartInterval</key>
  1529. 1529            <integer>86400</integer>
  1530. 1530      </dict>
  1531. 1531      </plist>
  1532. 1532  
  1533. 1533  Contents of /Library/LaunchDaemons/com.intego.netupdate.daemon.plist
  1534. 1534      -     mod date: Jun 29 08:50:18 2015
  1535. 1535      -     size (B): 456
  1536. 1536      -     checksum: 2886808918
  1537. 1537  
  1538. 1538      <?xml version="1.0" encoding="UTF-8"?>
  1539. 1539      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1540. 1540      <plist version="1.0">
  1541. 1541      <dict>
  1542. 1542            <key>Label</key>
  1543. 1543            <string>com.intego.netupdate.daemon</string>
  1544. 1544            <key>RunAtLoad</key>
  1545. 1545            <true/>
  1546. 1546            <key>KeepAlive</key>
  1547. 1547            <true/>
  1548. 1548            <key>ProgramArguments</key>
  1549. 1549            <array>
  1550. 1550                    <string>/Library/Intego/netupdated.bundle/Contents/Resources/com.intego.netupdated</string>
  1551. 1551            </array>
  1552. 1552      </dict>
  1553. 1553      </plist>
  1554. 1554  
  1555. 1555  Contents of /Library/LaunchDaemons/com.intego.virusbarrier.daemon.emlparser.plist
  1556. 1556      -     mod date: Sep  6 11:38:57 2013
  1557. 1557      -     size (B): 501
  1558. 1558      -     checksum: 3875365843
  1559. 1559  
  1560. 1560      <?xml version="1.0" encoding="UTF-8"?>
  1561. 1561      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1562. 1562      <plist version="1.0">
  1563. 1563      <dict>
  1564. 1564            <key>Label</key>
  1565. 1565            <string>com.intego.virusbarrier.daemon.emlparser</string>
  1566. 1566            <key>ProgramArguments</key>
  1567. 1567            <array>
  1568. 1568                    <string>/Library/Intego/virusbarrier.bundle/Contents/MacOS/vbemlparser</string>
  1569. 1569            </array>
  1570. 1570            <key>MachServices</key>
  1571. 1571            <dict>
  1572. 1572                    <key>com.intego.virusbarrier.daemon.emlparser</key>
  1573. 1573                    <true/>
  1574. 1574            </dict>
  1575. 1575      </dict>
  1576. 1576      </plist>
  1577. 1577  
  1578. 1578  Contents of /Library/LaunchDaemons/com.intego.virusbarrier.daemon.logger.plist
  1579. 1579      -     mod date: Sep  6 11:38:57 2013
  1580. 1580      -     size (B): 497
  1581. 1581      -     checksum: 1390371758
  1582. 1582  
  1583. 1583      <?xml version="1.0" encoding="UTF-8"?>
  1584. 1584      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1585. 1585      <plist version="1.0">
  1586. 1586      <dict>
  1587. 1587            <key>Label</key>
  1588. 1588            <string>com.intego.virusbarrier.daemon.logger</string>
  1589. 1589            <key>ProgramArguments</key>
  1590. 1590            <array>
  1591. 1591                    <string>/Library/Intego/virusbarrier.bundle/Contents/MacOS/virusbarrierl</string>
  1592. 1592            </array>
  1593. 1593            <key>MachServices</key>
  1594. 1594            <dict>
  1595. 1595                    <key>com.intego.virusbarrier.daemon.logger</key>
  1596. 1596                    <true/>
  1597. 1597            </dict>
  1598. 1598      </dict>
  1599. 1599      </plist>
  1600. 1600  
  1601. 1601  Contents of /Library/LaunchDaemons/com.intego.virusbarrier.daemon.plist
  1602. 1602      -     mod date: Sep  6 11:38:57 2013
  1603. 1603      -     size (B): 576
  1604. 1604      -     checksum: 2263010952
  1605. 1605  
  1606. 1606      <?xml version="1.0" encoding="UTF-8"?>
  1607. 1607      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1608. 1608      <plist version="1.0">
  1609. 1609      <dict>
  1610. 1610            <key>Label</key>
  1611. 1611            <string>com.intego.virusbarrier.daemon</string>
  1612. 1612            <key>KeepAlive</key>
  1613. 1613            <true/>
  1614. 1614            <key>ProgramArguments</key>
  1615. 1615            <array>
  1616. 1616                    <string>/Library/Intego/virusbarrier.bundle/Contents/MacOS/virusbarrierd</string>
  1617. 1617            </array>
  1618. 1618            <key>MachServices</key>
  1619. 1619            <dict>
  1620. 1620                    <key>com.intego.virusbarrier.daemon</key>
  1621. 1621                    <true/>
  1622. 1622                    <key>com.intego.virusbarrier.daemon.checkin</key>
  1623. 1623                    <true/>
  1624. 1624            </dict>
  1625. 1625      </dict>
  1626. 1626      </plist>
  1627. 1627  
  1628. 1628  Contents of /Library/LaunchDaemons/com.intego.virusbarrier.daemon.scanner.plist
  1629. 1629      -     mod date: Sep  6 11:38:57 2013
  1630. 1630      -     size (B): 499
  1631. 1631      -     checksum: 3058859818
  1632. 1632  
  1633. 1633      <?xml version="1.0" encoding="UTF-8"?>
  1634. 1634      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1635. 1635      <plist version="1.0">
  1636. 1636      <dict>
  1637. 1637            <key>Label</key>
  1638. 1638            <string>com.intego.virusbarrier.daemon.scanner</string>
  1639. 1639            <key>ProgramArguments</key>
  1640. 1640            <array>
  1641. 1641                    <string>/Library/Intego/virusbarrier.bundle/Contents/MacOS/virusbarriers</string>
  1642. 1642            </array>
  1643. 1643            <key>MachServices</key>
  1644. 1644            <dict>
  1645. 1645                    <key>com.intego.virusbarrier.daemon.scanner</key>
  1646. 1646                    <true/>
  1647. 1647            </dict>
  1648. 1648      </dict>
  1649. 1649      </plist>
  1650. 1650  
  1651. 1651  Contents of /Library/LaunchDaemons/com.iobit.AMCDaemon.plist
  1652. 1652      -     mod date: Nov  1 22:15:02 2015
  1653. 1653      -     size (B): 485
  1654. 1654      -     checksum: 3248374927
  1655. 1655  
  1656. 1656      <?xml version="1.0" encoding="UTF-8"?>
  1657. 1657      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1658. 1658      <plist version="1.0">
  1659. 1659      <dict>
  1660. 1660            <key>KeepAlive</key>
  1661. 1661            <true/>
  1662. 1662            <key>Label</key>
  1663. 1663            <string>com.iobit.AMCDaemon</string>
  1664. 1664            <key>UserName</key>
  1665. 1665            <string>root</string>
  1666. 1666            <key>ProgramArguments</key>
  1667. 1667            <array>
  1668. 1668                    <string>/Library/Application Support/AMC/AMCDaemon</string>
  1669. 1669                    <string>-load</string>
  1670. 1670            </array>
  1671. 1671            <key>RunAtLoad</key>
  1672. 1672            <true/>
  1673. 1673      </dict>
  1674. 1674      </plist>
  1675. 1675  
  1676. 1676  Contents of /Library/LaunchDaemons/com.maintain.CocktailScheduler.plist
  1677. 1677      -     Apple binary property list
  1678. 1678      -     mod date: Nov 11 20:06:37 2015
  1679. 1679      -     size (B): 547
  1680. 1680      -     checksum: 1500495412
  1681. 1681  
  1682. 1682      Dict {
  1683. 1683          ProgramArguments = Array {
  1684. 1684              /usr/bin/osascript
  1685. 1685              -e
  1686. 1686              try
  1687. 1687              -e
  1688. 1688              set schedulerOwner to do shell script "defaults read /Library/'Application Support'/Cocktail/Scheduler.plist SchedulerOwner"
  1689. 1689              -e
  1690. 1690              do shell script "users"
  1691. 1691              -e
  1692. 1692              if the result contains schedulerOwner then
  1693. 1693              -e
  1694. 1694              do shell script "/bin/sh /Library/'Application Support'/Cocktail/Scheduler.sh"
  1695. 1695              -e
  1696. 1696              end if
  1697. 1697              -e
  1698. 1698              end try
  1699. 1699          }
  1700. 1700          Disabled = false
  1701. 1701          StartCalendarInterval = Dict {
  1702. 1702              Hour = 3
  1703. 1703              Minute = 0
  1704. 1704          }
  1705. 1705          Label = com.maintain.cocktail.scheduler
  1706. 1706      }
  1707. 1707  
  1708. 1708  Contents of /Library/LaunchDaemons/com.maintain.HideSpotlightMenuBarIcon.plist
  1709. 1709      -     Apple binary property list
  1710. 1710      -     mod date: Jan 19 23:17:46 2015
  1711. 1711      -     size (B): 256
  1712. 1712      -     checksum: 2176217327
  1713. 1713  
  1714. 1714      Dict {
  1715. 1715          ProgramArguments = Array {
  1716. 1716              /bin/chmod
  1717. 1717              600
  1718. 1718              /System/Library/CoreServices/Spotlight.app/Contents/MacOS/Spotlight
  1719. 1719          }
  1720. 1720          StartInterval = 60
  1721. 1721          Disabled = true
  1722. 1722          Label = com.maintain.HideSpotlightMenuBarIcon
  1723. 1723          RunAtLoad = true
  1724. 1724      }
  1725. 1725  
  1726. 1726  Contents of /Library/LaunchDaemons/com.malwarebytes.MBAMHelperTool.plist
  1727. 1727      -     mod date: Oct 23 20:20:35 2015
  1728. 1728      -     size (B): 584
  1729. 1729      -     checksum: 2299099766
  1730. 1730  
  1731. 1731      <?xml version="1.0" encoding="UTF-8"?>
  1732. 1732      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1733. 1733      <plist version="1.0">
  1734. 1734      <dict>
  1735. 1735            <key>Label</key>
  1736. 1736            <string>com.malwarebytes.MBAMHelperTool</string>
  1737. 1737            <key>MachServices</key>
  1738. 1738            <dict>
  1739. 1739                    <key>com.malwarebytes.MBAMHelperTool</key>
  1740. 1740                    <true/>
  1741. 1741            </dict>
  1742. 1742            <key>Program</key>
  1743. 1743            <string>/Library/PrivilegedHelperTools/com.malwarebytes.MBAMHelperTool</string>
  1744. 1744            <key>ProgramArguments</key>
  1745. 1745            <array>
  1746. 1746                    <string>/Library/PrivilegedHelperTools/com.malwarebytes.MBAMHelperTool</string>
  1747. 1747            </array>
  1748. 1748      </dict>
  1749. 1749      </plist>
  1750. 1750  
  1751. 1751  Contents of /Library/LaunchDaemons/com.microsoft.autoupdate.helpertool.plist
  1752. 1752      -     mod date: Oct 16 14:20:46 2015
  1753. 1753      -     size (B): 600
  1754. 1754      -     checksum: 3423398678
  1755. 1755  
  1756. 1756      <?xml version="1.0" encoding="UTF-8"?>
  1757. 1757      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1758. 1758      <plist version="1.0">
  1759. 1759      <dict>
  1760. 1760            <key>Label</key>
  1761. 1761            <string>com.microsoft.autoupdate.helpertool</string>
  1762. 1762            <key>MachServices</key>
  1763. 1763            <dict>
  1764. 1764                    <key>com.microsoft.autoupdate.helpertool</key>
  1765. 1765                    <true/>
  1766. 1766            </dict>
  1767. 1767            <key>Program</key>
  1768. 1768            <string>/Library/PrivilegedHelperTools/com.microsoft.autoupdate.helpertool</string>
  1769. 1769            <key>ProgramArguments</key>
  1770. 1770            <array>
  1771. 1771                    <string>/Library/PrivilegedHelperTools/com.microsoft.autoupdate.helpertool</string>
  1772. 1772            </array>
  1773. 1773      </dict>
  1774. 1774      </plist>
  1775. 1775  
  1776. 1776  Contents of /Library/LaunchDaemons/com.microsoft.office.licensingV2.helper.plist
  1777. 1777      -     mod date: Aug  7 02:55:38 2015
  1778. 1778      -     size (B): 657
  1779. 1779      -     checksum: 1698653368
  1780. 1780  
  1781. 1781      <?xml version="1.0" encoding="UTF-8"?>
  1782. 1782      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1783. 1783      <plist version="1.0">
  1784. 1784      <dict>
  1785. 1785            <key>Label</key>
  1786. 1786            <string>com.microsoft.office.licensingV2.helper</string>
  1787. 1787          <key>MachServices</key>
  1788. 1788          <dict>
  1789. 1789              <key>com.microsoft.office.licensingV2.helper.port</key>
  1790. 1790              <true/>
  1791. 1791          </dict>
  1792. 1792          <key>Program</key>
  1793. 1793              <string>/Library/PrivilegedHelperTools/com.microsoft.office.licensingV2.helper</string>
  1794. 1794          <key>ProgramArguments</key>
  1795. 1795            <array>
  1796. 1796                    <string>/Library/PrivilegedHelperTools/com.microsoft.office.licensingV2.helper</string>
  1797. 1797            </array>
  1798. 1798       </dict>
  1799. 1799      </plist>
  1800. 1800  
  1801. 1801  Contents of /Library/LaunchDaemons/com.paragon.NTFS.launch.plist
  1802. 1802      -     exported SGML document text
  1803. 1803      -     mod date: Oct 23 05:55:52 2015
  1804. 1804      -     size (B): 641
  1805. 1805      -     checksum: 1766326959
  1806. 1806  
  1807. 1807      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1808. 1808      <plist version="1.0">
  1809. 1809      <dict>
  1810. 1810              <key>KeepAlive</key>
  1811. 1811              <false/>
  1812. 1812              <key>Label</key>
  1813. 1813              <string>com.paragon.NTFS.launch</string>
  1814. 1814              <key>ProgramArguments</key>
  1815. 1815              <array>
  1816. 1816                      <string>/sbin/kextload</string>
  1817. 1817                      <string>/Library/Extensions/ufsd_NTFS.kext</string>
  1818. 1818              </array>
  1819. 1819              <key>RunAtLoad</key>
  1820. 1820              <true/>
  1821. 1821              <key>StandardErrorPath</key>
  1822. 1822              <string>/dev/null</string>
  1823. 1823              <key>StandardOutPath</key>
  1824. 1824              <string>/dev/null</string>
  1825. 1825      </dict>
  1826. 1826      </plist>
  1827. 1827  
  1828. 1828  Contents of /Library/LaunchDaemons/com.robohippo.HippoConnectDaemon.plist
  1829. 1829      -     mod date: Jan  7 01:36:47 2014
  1830. 1830      -     size (B): 722
  1831. 1831      -     checksum: 2324563567
  1832. 1832  
  1833. 1833      <?xml version="1.0" encoding="UTF-8"?>
  1834. 1834      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1835. 1835      <plist version="1.0">
  1836. 1836      <dict>
  1837. 1837            <key>GroupName</key>
  1838. 1838            <string>wheel</string>
  1839. 1839            <key>KeepAlive</key>
  1840. 1840            <true/>
  1841. 1841            <key>Label</key>
  1842. 1842            <string>com.robohippo.HippoConnectDaemon</string>
  1843. 1843            <key>LimitLoadToSessionType</key>
  1844. 1844            <array>
  1845. 1845                    <string>LoginWindow</string>
  1846. 1846            </array>
  1847. 1847            <key>OnDemand</key>
  1848. 1848            <false/>
  1849. 1849            <key>ProgramArguments</key>
  1850. 1850            <array>
  1851. 1851                    <string>/Library/Application Support/HippoConnect/HippoConnectAgent</string>
  1852. 1852                    <string>-d</string>
  1853. 1853                    <string>-p</string>
  1854. 1854                    <string>c0nn0r</string>
  1855. 1855            </array>
  1856. 1856            <key>RunAtLoad</key>
  1857. 1857            <true/>
  1858. 1858  
  1859. 1859      ...and 4 more line(s)
  1860. 1860  
  1861. 1861  Contents of /Library/LaunchDaemons/com.siber.gs-server.plist
  1862. 1862      -     mod date: Oct 23 11:32:05 2015
  1863. 1863      -     size (B): 441
  1864. 1864      -     checksum: 2477576512
  1865. 1865  
  1866. 1866      <?xml version="1.0" encoding="UTF-8"?>
  1867. 1867      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1868. 1868      <plist version="1.0">
  1869. 1869      <dict>
  1870. 1870            <key>Label</key>
  1871. 1871            <string>gs-server</string>
  1872. 1872            <key>ProgramArguments</key>
  1873. 1873            <array>
  1874. 1874                    <string>/Library/Application Support/GoodSync/gs-server</string>
  1875. 1875            </array>
  1876. 1876            <key>RunAtLoad</key>
  1877. 1877            <true/>
  1878. 1878            <key>onDemand</key>
  1879. 1879            <false/>
  1880. 1880            <key>Disable</key>
  1881. 1881            <false/>
  1882. 1882      </dict>
  1883. 1883      </plist>
  1884. 1884  
  1885. 1885  Contents of /Library/LaunchDaemons/com.sibersystems.GsRunner-gvantass.plist
  1886. 1886      -     mod date: Oct 26 19:31:50 2015
  1887. 1887      -     size (B): 470
  1888. 1888      -     checksum: 3336912374
  1889. 1889  
  1890. 1890      <?xml version="1.0" encoding="UTF-8"?>
  1891. 1891      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1892. 1892      <plist version="1.0">
  1893. 1893      <dict>
  1894. 1894            <key>KeepAlive</key>
  1895. 1895            <false/>
  1896. 1896            <key>Label</key>
  1897. 1897            <string>com.sibersystems.GsRunner-gvantass</string>
  1898. 1898            <key>Program</key>
  1899. 1899            <string>/Users/USER/Library/Application Support/GoodSync/GsRunner</string>
  1900. 1900            <key>RunAtLoad</key>
  1901. 1901            <true/>
  1902. 1902            <key>UserName</key>
  1903. 1903            <string>gvantass</string>
  1904. 1904      </dict>
  1905. 1905      </plist>
  1906. 1906  
  1907. 1907  Contents of /Library/LaunchDaemons/com.soma-zone.LaunchControl.Helper.plist
  1908. 1908      -     mod date: Oct 31 22:46:31 2015
  1909. 1909      -     size (B): 596
  1910. 1910      -     checksum: 2409053696
  1911. 1911  
  1912. 1912      <?xml version="1.0" encoding="UTF-8"?>
  1913. 1913      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1914. 1914      <plist version="1.0">
  1915. 1915      <dict>
  1916. 1916            <key>Label</key>
  1917. 1917            <string>com.soma-zone.LaunchControl.Helper</string>
  1918. 1918            <key>MachServices</key>
  1919. 1919            <dict>
  1920. 1920                    <key>com.soma-zone.LaunchControl.Helper</key>
  1921. 1921                    <true/>
  1922. 1922            </dict>
  1923. 1923            <key>Program</key>
  1924. 1924            <string>/Library/PrivilegedHelperTools/com.soma-zone.LaunchControl.Helper</string>
  1925. 1925            <key>ProgramArguments</key>
  1926. 1926            <array>
  1927. 1927                    <string>/Library/PrivilegedHelperTools/com.soma-zone.LaunchControl.Helper</string>
  1928. 1928            </array>
  1929. 1929      </dict>
  1930. 1930      </plist>
  1931. 1931  
  1932. 1932  Contents of /Library/LaunchDaemons/com.speedtools.scheduleagent.plist
  1933. 1933      -     mod date: Dec 13 21:27:53 2014
  1934. 1934      -     size (B): 480
  1935. 1935      -     checksum: 2191118651
  1936. 1936  
  1937. 1937      <?xml version="1.0" encoding="UTF-8"?>
  1938. <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1939. <plist version="1.0">
  1940. <dict>
  1941.         <key>Label</key>
  1942.         <string>com.speedtools.scheduleagent</string>
  1943.         <key>Program</key>
  1944.         <string>/Library/Application Support/SpeedTools Utilities Support/STU_Helper/STScheduleAgent/STScheduleAgent</string>
  1945.         <key>RunAtLoad</key>
  1946.         <true/>
  1947.         <key>StandardErrorPath</key>
  1948.         <string>/dev/null</string>
  1949. </dict>
  1950. </plist>
  1951. 1938  
  1952. 1939  Contents of /Library/LaunchDaemons/com.splashtop.streamer-daemon.plist
  1953. 1940      -     mod date: Sep 23 04:16:29 2015
  1954. 1941      -     size (B): 392
  1955. 1942      -     checksum: 2644417781
  1956. 1943  
  1957. 1944      <?xml version="1.0" encoding="UTF-8"?>
  1958. 1945      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1959. 1946      <plist version="1.0">
  1960. 1947      <dict>
  1961. 1948            <key>Label</key>
  1962. 1949            <string>com.splashtop.streamer-daemon</string>
  1963. 1950            <key>KeepAlive</key>
  1964. 1951            <true/>
  1965. 1952            <key>Program</key>
  1966. 1953            <string>/Applications/Splashtop Streamer.app/Contents/MacOS/SRStreamerDaemon</string>
  1967. 1954      </dict>
  1968. 1955      </plist>
  1969. 1956  
  1970. 1957  Contents of /Library/LaunchDaemons/com.splashtop.streamer-srioframebuffer.plist
  1971. 1958      -     mod date: Sep 23 04:16:29 2015
  1972. 1959      -     size (B): 585
  1973. 1960      -     checksum: 358314194
  1974. 1961  
  1975. 1962      <?xml version="1.0" encoding="UTF-8"?>
  1976. 1963      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  1977. 1964      <plist version="1.0">
  1978. 1965      <dict>
  1979. 1966            <key>Label</key>
  1980. 1967            <string>com.splashtop.streamer-srioframebuffer</string>
  1981. 1968            <key>KeepAlive</key>
  1982. 1969            <dict>
  1983. 1970                    <key>SuccessfulExit</key>
  1984. 1971                    <false/>
  1985. 1972                    <key>AfterInitialDemand</key>
  1986. 1973                    <false/>
  1987. 1974            </dict>
  1988. 1975            <key>RunAtLoad</key>
  1989. 1976            <true/>
  1990. 1977            <key>ProgramArguments</key>
  1991. 1978            <array>
  1992. 1979                    <string>/Applications/Splashtop Streamer.app/Contents/MacOS/SRIOFrameBuffer.app/Contents/MacOS/SRIOFrameBuffer</string>
  1993. 1980            </array>
  1994. 1981      </dict>
  1995. 1982      </plist>
  1996. 1983  
  1997. 1984  Contents of /Library/LaunchDaemons/com.surteesstudios.Bartender.BartenderInstallHelper.plist
  1998. 1985      -     mod date: Oct  9 01:23:37 2015
  1999. 1986      -     size (B): 664
  2000. 1987      -     checksum: 534097078
  2001. 1988  
  2002. 1989      <?xml version="1.0" encoding="UTF-8"?>
  2003. 1990      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2004. 1991      <plist version="1.0">
  2005. 1992      <dict>
  2006. 1993            <key>Label</key>
  2007. 1994            <string>com.surteesstudios.Bartender.BartenderInstallHelper</string>
  2008. 1995            <key>MachServices</key>
  2009. 1996            <dict>
  2010. 1997                    <key>com.surteesstudios.Bartender.BartenderInstallHelper</key>
  2011. 1998                    <true/>
  2012. 1999            </dict>
  2013. 2000            <key>Program</key>
  2014. 2001            <string>/Library/PrivilegedHelperTools/com.surteesstudios.Bartender.BartenderInstallHelper</string>
  2015. 2002            <key>ProgramArguments</key>
  2016. 2003            <array>
  2017. 2004                    <string>/Library/PrivilegedHelperTools/com.surteesstudios.Bartender.BartenderInstallHelper</string>
  2018. 2005            </array>
  2019. 2006      </dict>
  2020. 2007      </plist>
  2021. 2008  
  2022. 2009  Contents of /Library/LaunchDaemons/com.tunabellysoftware.TGFanHelper.plist
  2023. 2010      -     mod date: Sep 30 21:38:06 2015
  2024. 2011      -     size (B): 592
  2025. 2012      -     checksum: 3565692930
  2026. 2013  
  2027. 2014      <?xml version="1.0" encoding="UTF-8"?>
  2028. 2015      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2029. 2016      <plist version="1.0">
  2030. 2017      <dict>
  2031. 2018            <key>Label</key>
  2032. 2019            <string>com.tunabellysoftware.TGFanHelper</string>
  2033. 2020            <key>MachServices</key>
  2034. 2021            <dict>
  2035. 2022                    <key>com.tunabellysoftware.TGFanHelper</key>
  2036. 2023                    <true/>
  2037. 2024            </dict>
  2038. 2025            <key>Program</key>
  2039. 2026            <string>/Library/PrivilegedHelperTools/com.tunabellysoftware.TGFanHelper</string>
  2040. 2027            <key>ProgramArguments</key>
  2041. 2028            <array>
  2042. 2029                    <string>/Library/PrivilegedHelperTools/com.tunabellysoftware.TGFanHelper</string>
  2043. 2030            </array>
  2044. 2031      </dict>
  2045. 2032      </plist>
  2046. 2033  
  2047. 2034  Contents of /Library/LaunchDaemons/comp.text.tex.distribution.Helper.plist
  2048. 2035      -     mod date: Oct  1 21:24:16 2015
  2049. 2036      -     size (B): 677
  2050. 2037      -     checksum: 778879715
  2051. 2038  
  2052. 2039      <?xml version="1.0" encoding="UTF-8"?>
  2053. 2040      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2054. 2041      <plist version="1.0">
  2055. 2042      <dict>
  2056. 2043            <key>Label</key>
  2057. 2044            <string>comp.text.tex.distribution.Helper</string>
  2058. 2045            <key>MachServices</key>
  2059. 2046            <dict>
  2060. 2047                    <key>comp.text.tex.distribution.Helper</key>
  2061. 2048                    <true/>
  2062. 2049            </dict>
  2063. 2050            <key>ProgramArguments</key>
  2064. 2051            <array>
  2065. 2052                    <string>/Library/PreferencePanes/TeXDistPrefPane.prefPane/Contents/Library/LaunchServices/comp.text.tex.distribution.Helper</string>
  2066. 2053                    <string>--launch-service</string>
  2067. 2054                    <string>--version</string>
  2068. 2055                    <string>271</string>
  2069. 2056                    <string>--pid</string>
  2070. 2057                    <string>1843</string>
  2071. 2058            </array>
  2072. 2059      </dict>
  2073. 2060      </plist>
  2074. 2061  
  2075. 2062  Contents of /Library/LaunchDaemons/org.cindori.CCAuth.plist
  2076. 2063      -     mod date: Feb  7 19:56:37 2015
  2077. 2064      -     size (B): 532
  2078. 2065      -     checksum: 2771150299
  2079. 2066  
  2080. 2067      <?xml version="1.0" encoding="UTF-8"?>
  2081. 2068      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2082. 2069      <plist version="1.0">
  2083. 2070      <dict>
  2084. 2071            <key>Label</key>
  2085. 2072            <string>org.cindori.CCAuth</string>
  2086. 2073            <key>MachServices</key>
  2087. 2074            <dict>
  2088. 2075                    <key>org.cindori.CCAuth</key>
  2089. 2076                    <true/>
  2090. 2077            </dict>
  2091. 2078            <key>Program</key>
  2092. 2079            <string>/Library/PrivilegedHelperTools/org.cindori.CCAuth</string>
  2093. 2080            <key>ProgramArguments</key>
  2094. 2081            <array>
  2095. 2082                    <string>/Library/PrivilegedHelperTools/org.cindori.CCAuth</string>
  2096. 2083            </array>
  2097. 2084      </dict>
  2098. 2085      </plist>
  2099. 2086  
  2100. 2087  Contents of /Library/LaunchDaemons/org.gpgtools.gpgmail.patch-uuid.plist
  2101. 2088      -     mod date: Mar  8 08:03:00 2015
  2102. 2089      -     size (B): 410
  2103. 2090      -     checksum: 4206690072
  2104. 2091  
  2105. 2092      <?xml version="1.0" encoding="UTF-8"?>
  2106. 2093      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2107. 2094      <plist version="1.0">
  2108. 2095      <dict>
  2109. 2096            <key>Label</key>
  2110. 2097            <string>org.gpgtools.gpgmail.uuid-patcher</string>
  2111. 2098            <key>Program</key>
  2112. 2099            <string>/Library/Application Support/GPGTools/uuid-patcher</string>
  2113. 2100            <key>RunAtLoad</key>
  2114. 2101            <true/>
  2115. 2102            <key>KeepAlive</key>
  2116. 2103            <false/>
  2117. 2104      </dict>
  2118. 2105      </plist>
  2119. 2106  
  2120. 2107  Contents of /System/Library/LaunchAgents/net.culater.SIMBL.Agent.plist
  2121. 2108      -     mod date: Oct 24 21:21:27 2015
  2122. 2109      -     size (B): 515
  2123. 2110      -     checksum: 1016867470
  2124. 2111  
  2125. 2112      <?xml version="1.0" encoding="UTF-8"?>
  2126. 2113      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2127. 2114      <plist version="1.0">
  2128. 2115      <dict>
  2129. 2116            <key>Label</key>
  2130. 2117            <string>net.culater.SIMBL.Agent</string>
  2131. 2118            <key>Program</key>
  2132. 2119            <string>/System/Library/ScriptingAdditions/SIMBL.osax/Contents/Resources/SIMBL Agent.app/Contents/MacOS/SIMBL Agent</string>
  2133. 2120            <key>RunAtLoad</key>
  2134. 2121            <false/>
  2135. 2122            <key>LimitLoadToSessionType</key>
  2136. 2123            <string>Aqua</string>
  2137. 2124            <key>OnDemand</key>
  2138. 2125            <false/>
  2139. 2126      </dict>
  2140. 2127      </plist>
  2141. 2128  
  2142. 2129  Contents of /private/etc/hosts
  2143. 2130      -     mod date: Sep 22 19:45:41 2015
  2144. 2131      -     size (B): 236
  2145. 2132      -     checksum: 85078130
  2146. 2133  
  2147. 2134      127.0.0.1     localhost
  2148. 2135      255.255.255.255       broadcasthost
  2149. 2136      ::1             localhost
  2150. 2137      fe80::1%lo0   localhost
  2151. 2138  
  2152. 2139  Contents of Library/LaunchAgents/com.adobe.ARM.UUID.plist
  2153. 2140      -     mod date: Mar 12 13:21:49 2015
  2154. 2141      -     size (B): 603
  2155. 2142      -     checksum: 394026997
  2156. 2143  
  2157. 2144      <?xml version="1.0" encoding="UTF-8"?>
  2158. 2145      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2159. 2146      <plist version="1.0">
  2160. 2147      <dict>
  2161. 2148            <key>Label</key>
  2162. 2149            <string>com.adobe.ARM.UUID</string>
  2163. 2150            <key>ProgramArguments</key>
  2164. 2151            <array>
  2165. 2152                    <string>/Applications/Adobe Reader.app/Contents/MacOS/Updater/Adobe Reader Updater Helper.app/Contents/MacOS/Adobe Reader Updater Helper</string>
  2166. 2153                    <string>semi-auto</string>
  2167. 2154            </array>
  2168. 2155            <key>RunAtLoad</key>
  2169. 2156            <true/>
  2170. 2157            <key>StartInterval</key>
  2171. 2158            <integer>12600</integer>
  2172. 2159      </dict>
  2173. 2160      </plist>
  2174. 2161  
  2175. 2162  Contents of Library/LaunchAgents/com.amazon.music.plist
  2176. 2163      -     mod date: Sep 27 15:04:21 2015
  2177. 2164      -     size (B): 448
  2178. 2165      -     checksum: 3668832669
  2179. 2166  
  2180. 2167      <?xml version="1.0" encoding="UTF-8"?>
  2181. 2168      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2182. 2169      <plist version="1.0">
  2183. 2170      <dict>
  2184. 2171            <key>EnableTransactions</key>
  2185. 2172            <false/>
  2186. 2173            <key>KeepAlive</key>
  2187. 2174            <true/>
  2188. 2175            <key>Label</key>
  2189. 2176            <string>com.amazon.music</string>
  2190. 2177            <key>Program</key>
  2191. 2178            <string>/Applications/Amazon Music.app/Contents/MacOS/Amazon Music Helper</string>
  2192. 2179            <key>RunAtLoad</key>
  2193. 2180            <true/>
  2194. 2181      </dict>
  2195. 2182      </plist>
  2196. 2183  
  2197. 2184  Contents of Library/LaunchAgents/com.couchpotato.movies.plist
  2198. 2185      -     mod date: Aug 28 17:07:45 2015
  2199. 2186      -     size (B): 618
  2200. 2187      -     checksum: 2650482328
  2201. 2188  
  2202. 2189      <?xml version="1.0" encoding="UTF-8"?>
  2203. 2190      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2204. 2191      <plist version="1.0">
  2205. 2192      <dict>
  2206. 2193            <key>Label</key>
  2207. 2194            <string>com.couchpotato.movies</string>
  2208. 2195            <key>ProgramArguments</key>
  2209. 2196            <array>
  2210. 2197                    <string>/usr/local/bin/python</string>
  2211. 2198                    <string>/Applications/CouchPotatoServer/CouchPotato.py</string>
  2212. 2199                    <string>--quiet</string>
  2213. 2200            </array>
  2214. 2201            <key>RunAtLoad</key>
  2215. 2202            <true/>
  2216. 2203            <key>StandardErrorPath</key>
  2217. 2204            <string>/tmp/com.couchpotato.movies.err</string>
  2218. 2205            <key>StandardOutPath</key>
  2219. 2206            <string>/tmp/com.couchpotato.movies.out</string>
  2220. 2207      </dict>
  2221. 2208      </plist>
  2222. 2209  
  2223. 2210  Contents of Library/LaunchAgents/com.ecamm.printopia.plist
  2224. 2211      -     mod date: Sep 19 05:26:20 2015
  2225. 2212      -     size (B): 457
  2226. 2213      -     checksum: 1467394531
  2227. 2214  
  2228. 2215      <?xml version="1.0" encoding="UTF-8"?>
  2229. 2216      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2230. 2217      <plist version="1.0">
  2231. 2218      <dict>
  2232. 2219            <key>Label</key>
  2233. 2220            <string>com.ecamm.printopia</string>
  2234. 2221            <key>Program</key>
  2235. 2222            <string>/Users/USER/Library/PreferencePanes/Printopia.prefPane/Contents/MacOS/Printopia Server.app/Contents/MacOS/Printopia Server</string>
  2236. 2223            <key>StartInterval</key>
  2237. 2224            <integer>3</integer>
  2238. 2225      </dict>
  2239. 2226      </plist>
  2240. 2227  
  2241. 2228  Contents of Library/LaunchAgents/com.erikhinterbichler.HeraldLaunchAgent.plist
  2242. 2229      -     mod date: Oct 23 04:24:03 2015
  2243. 2230      -     size (B): 543
  2244. 2231      -     checksum: 1144872817
  2245. 2232  
  2246. 2233      <?xml version="1.0" encoding="UTF-8"?>
  2247. 2234      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2248. 2235      <plist version="1.0">
  2249. 2236      <dict>
  2250. 2237            <key>KeepAlive</key>
  2251. 2238            <true/>
  2252. 2239            <key>Label</key>
  2253. 2240            <string>com.erikhinterbichler.HeraldLaunchAgent</string>
  2254. 2241            <key>LimitLoadToSessionType</key>
  2255. 2242            <string>Aqua</string>
  2256. 2243            <key>ProgramArguments</key>
  2257. 2244            <array>
  2258. 2245                    <string>/Users/USER/Library/Mail/Bundles/Herald.mailbundle/Contents/Resources/HeraldLaunchAgent</string>
  2259. 2246            </array>
  2260. 2247            <key>RunAtLoad</key>
  2261. 2248            <true/>
  2262. 2249      </dict>
  2263. 2250      </plist>
  2264. 2251  
  2265. 2252  Contents of Library/LaunchAgents/com.iobit.MacBoosterMini.plist
  2266. 2253      -     mod date: Nov  9 22:22:26 2015
  2267. 2254      -     size (B): 473
  2268. 2255      -     checksum: 500596684
  2269. 2256  
  2270. 2257      <?xml version="1.0" encoding="UTF-8"?>
  2271. 2258      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2272. 2259      <plist version="1.0">
  2273. 2260      <dict>
  2274. 2261            <key>KeepAlive</key>
  2275. 2262            <true/>
  2276. 2263            <key>Label</key>
  2277. 2264            <string>com.iobit.MacBooster-mini</string>
  2278. 2265            <key>Program</key>
  2279. 2266            <string>/Users/USER/Library/Application Support/MacBooster 3/MacBooster mini.app/Contents/MacOS/MacBooster mini</string>
  2280. 2267            <key>Version</key>
  2281. 2268            <integer>14053</integer>
  2282. 2269      </dict>
  2283. 2270      </plist>
  2284. 2271  
  2285. 2272  Contents of Library/LaunchAgents/com.iobit.iosMonitor.plist
  2286. 2273      -     mod date: Jan  4 23:28:38 2015
  2287. 2274      -     size (B): 540
  2288. 2275      -     checksum: 1735592826
  2289. 2276  
  2290. 2277      <?xml version="1.0" encoding="UTF-8"?>
  2291. 2278      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2292. 2279      <plist version="1.0">
  2293. 2280      <dict>
  2294. 2281            <key>KeepAlive</key>
  2295. 2282            <true/>
  2296. 2283            <key>Label</key>
  2297. 2284            <string>com.iobit.iosMonitor</string>
  2298. 2285            <key>MainApp</key>
  2299. 2286            <string>/Applications/iFreeUp.app/Contents/MacOS/iFreeUp</string>
  2300. 2287            <key>Program</key>
  2301. 2288            <string>/Users/USER/Library/Application Support/iFreeup/iosMonitor.app/Contents/MacOS/iosMonitor</string>
  2302. 2289            <key>Version</key>
  2303. 2290            <integer>11609</integer>
  2304. 2291      </dict>
  2305. 2292      </plist>
  2306. 2293  
  2307. 2294  Contents of Library/LaunchAgents/com.littleknownsoftware.MailPluginTool-Startup.plist
  2308. 2295      -     mod date: Jul 22 03:06:47 2015
  2309. 2296      -     size (B): 598
  2310. 2297      -     checksum: 3693610461
  2311. 2298  
  2312. 2299      <?xml version="1.0" encoding="UTF-8"?>
  2313. 2300      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2314. 2301      <plist version="1.0">
  2315. 2302      <dict>
  2316. 2303            <key>KeepAlive</key>
  2317. 2304            <false/>
  2318. 2305            <key>Label</key>
  2319. 2306            <string>com.littleknownsoftware.MailPluginTool-Startup</string>
  2320. 2307            <key>LimitLoadToSessionType</key>
  2321. 2308            <string>Aqua</string>
  2322. 2309            <key>ProgramArguments</key>
  2323. 2310            <array>
  2324. 2311                    <string>/Applications/Mail Plugin Manager.app/Contents/Resources/MailPluginTool.app/Contents/MacOS/MailPluginTool</string>
  2325. 2312                    <string>-validate-all</string>
  2326. 2313            </array>
  2327. 2314            <key>RunAtLoad</key>
  2328. 2315            <true/>
  2329. 2316      </dict>
  2330. 2317      </plist>
  2331. 2318  
  2332. 2319  Contents of Library/LaunchAgents/com.littleknownsoftware.MailPluginTool-Watcher.plist
  2333. 2320      -     mod date: Nov 14 01:43:18 2015
  2334. 2321      -     size (B): 664
  2335. 2322      -     checksum: 4288715610
  2336. 2323  
  2337. 2324      <?xml version="1.0" encoding="UTF-8"?>
  2338. 2325      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2339. 2326      <plist version="1.0">
  2340. 2327      <dict>
  2341. 2328            <key>KeepAlive</key>
  2342. 2329            <false/>
  2343. 2330            <key>Label</key>
  2344. 2331            <string>com.littleknownsoftware.MailPluginTool-Watcher</string>
  2345. 2332            <key>LimitLoadToSessionType</key>
  2346. 2333            <string>Aqua</string>
  2347. 2334            <key>ProgramArguments</key>
  2348. 2335            <array>
  2349. 2336                    <string>/Applications/Mail Plugin Manager.app/Contents/Resources/MailPluginTool.app/Contents/MacOS/MailPluginTool</string>
  2350. 2337                    <string>-file-load</string>
  2351. 2338            </array>
  2352. 2339            <key>QueueDirectories</key>
  2353. 2340            <array>
  2354. 2341                    <string>/Users/USER/Library/Mail/MPT</string>
  2355. 2342            </array>
  2356. 2343      </dict>
  2357. 2344      </plist>
  2358. 2345  
  2359. 2346  Contents of Library/LaunchAgents/com.maintain.ShowUserLibraryDirectory.plist
  2360. 2347      -     Apple binary property list
  2361. 2348      -     mod date: Nov 11 20:04:36 2015
  2362. 2349      -     size (B): 206
  2363. 2350      -     checksum: 4070925063
  2364. 2351  
  2365. 2352      Dict {
  2366. 2353          ProgramArguments = Array {
  2367. 2354              /usr/bin/chflags
  2368. 2355              nohidden
  2369. 2356              /Users/USER/Library/
  2370. 2357          }
  2371. 2358          RunAtLoad = true
  2372. 2359          Disabled = false
  2373. 2360          Label = com.maintain.ShowUserLibraryDirectory
  2374. 2361      }
  2375. 2362  
  2376. 2363  Contents of Library/LaunchAgents/com.rembo10.headphones.plist
  2377. 2364      -     mod date: Oct 26 05:30:26 2015
  2378. 2365      -     size (B): 643
  2379. 2366      -     checksum: 3167464890
  2380. 2367  
  2381. 2368      <?xml version="1.0" encoding="UTF-8"?>
  2382. 2369      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2383. 2370      <plist version="1.0">
  2384. 2371      <dict>
  2385. 2372            <key>Disabled</key>
  2386. 2373            <true/>
  2387. 2374            <key>Label</key>
  2388. 2375            <string>com.rembo10.headphones</string>
  2389. 2376            <key>ProgramArguments</key>
  2390. 2377            <array>
  2391. 2378                    <string>/usr/bin/python</string>
  2392. 2379                    <string>/Applications/Headphones/Headphones.py</string>
  2393. 2380                    <string>--nolaunch</string>
  2394. 2381            </array>
  2395. 2382            <key>RunAtLoad</key>
  2396. 2383            <true/>
  2397. 2384            <key>StandardErrorPath</key>
  2398. 2385            <string>/tmp/com.rembo10.headphones.stderr</string>
  2399. 2386            <key>StandardOutPath</key>
  2400. 2387            <string>/tmp/com.rembo10.headphones.stdout</string>
  2401. 2388      </dict>
  2402. 2389      </plist>
  2403. 2390  
  2404. 2391  Contents of Library/LaunchAgents/com.sickbeard.tv.plist
  2405. 2392      -     mod date: Jan 29 02:42:58 2015
  2406. 2393      -     size (B): 623
  2407. 2394      -     checksum: 2332424744
  2408. 2395  
  2409. 2396      <?xml version="1.0" encoding="UTF-8"?>
  2410. 2397      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2411. 2398      <plist version="1.0">
  2412. 2399      <dict>
  2413. 2400            <key>Disabled</key>
  2414. 2401            <false/>
  2415. 2402            <key>Label</key>
  2416. 2403            <string>com.sickbeard.tv</string>
  2417. 2404            <key>ProgramArguments</key>
  2418. 2405            <array>
  2419. 2406                    <string>/usr/bin/python</string>
  2420. 2407                    <string>/Applications/Sick-Beard-development/SickBeard.py</string>
  2421. 2408                    <string>-q</string>
  2422. 2409            </array>
  2423. 2410            <key>RunAtLoad</key>
  2424. 2411            <true/>
  2425. 2412            <key>StandardErrorPath</key>
  2426. 2413            <string>/tmp/com.sickbeard.tv.err</string>
  2427. 2414            <key>StandardOutPath</key>
  2428. 2415            <string>/tmp/com.sickbeard.tv.out</string>
  2429. 2416      </dict>
  2430. 2417      </plist>
  2431. 2418  
  2432. 2419  Contents of Library/LaunchAgents/com.splashtop.streamer-for-user.plist
  2433. 2420      -     mod date: Nov 14 01:33:29 2015
  2434. 2421      -     size (B): 653
  2435. 2422      -     checksum: 444089276
  2436. 2423  
  2437. 2424      <?xml version="1.0" encoding="UTF-8"?>
  2438. 2425      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2439. 2426      <plist version="1.0">
  2440. 2427      <dict>
  2441. 2428            <key>KeepAlive</key>
  2442. 2429            <dict>
  2443. 2430                    <key>AfterInitialDemand</key>
  2444. 2431                    <true/>
  2445. 2432                    <key>SuccessfulExit</key>
  2446. 2433                    <false/>
  2447. 2434            </dict>
  2448. 2435            <key>Label</key>
  2449. 2436            <string>com.splashtop.streamer-for-user</string>
  2450. 2437            <key>LimitLoadToSessionType</key>
  2451. 2438            <array>
  2452. 2439                    <string>Aqua</string>
  2453. 2440            </array>
  2454. 2441            <key>ProgramArguments</key>
  2455. 2442            <array>
  2456. 2443                    <string>/Applications/Splashtop Streamer.app/Contents/MacOS/Splashtop Streamer</string>
  2457. 2444                    <string>RunAtLogin</string>
  2458. 2445            </array>
  2459. 2446            <key>RunAtLoad</key>
  2460. 2447            <true/>
  2461. 2448      </dict>
  2462. 2449  
  2463. 2450      ...and 1 more line(s)
  2464. 2451  
  2465. 2452  Contents of Library/LaunchAgents/com.spotify.webhelper.plist
  2466. 2453      -     mod date: Aug  6 22:32:43 2015
  2467. 2454      -     size (B): 535
  2468. 2455      -     checksum: 4220650840
  2469. 2456  
  2470. 2457      <?xml version="1.0" encoding="UTF-8"?>
  2471. 2458      <!DOCTYPE plist PUBLIC "-//Apple Computer//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2472. 2459      <plist version="1.0">
  2473. 2460      <dict>
  2474. 2461       <key>Label</key>
  2475. 2462       <string>com.spotify.webhelper</string>
  2476. 2463       <key>KeepAlive</key>
  2477. 2464       <dict>
  2478. 2465        <key>NetworkState</key>
  2479. 2466        <true/>
  2480. 2467       </dict>
  2481. 2468       <key>RunAtLoad</key>
  2482. 2469       <true/>
  2483. 2470       <key>Program</key>
  2484. 2471       <string>/Users/USER/Library/Application Support/Spotify/SpotifyWebHelper</string>
  2485. 2472       <key>SpotifyPath</key>
  2486. 2473       <string>/Applications/Spotify.app</string></dict>
  2487. 2474      </plist>
  2488. 2475  
  2489. 2476  Contents of Library/LaunchAgents/com.valvesoftware.steamclean.plist
  2490. 2477      -     mod date: Mar 11 22:32:44 2015
  2491. 2478      -     size (B): 830
  2492. 2479      -     checksum: 3009856838
  2493. 2480  
  2494. 2481      <?xml version="1.0" encoding="UTF-8"?>
  2495. 2482      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  2496. 2483      <plist version="1.0">
  2497. 2484      <dict>
  2498. 2485            <key>Label</key>
  2499. 2486            <string>com.valvesoftware.steamclean</string>
  2500. 2487            <key>Program</key>
  2501. 2488            <string>/Users/USER/Library/Application Support/Steam/SteamApps/steamclean</string>
  2502. 2489            <key>ProgramArguments</key>
  2503. 2490            <array>
  2504. 2491                    <string>/Users/USER/Library/Application Support/Steam/SteamApps/steamclean/disable</string>
  2505. 2492                    <string>Public</string>
  2506. 2493            </array>
  2507. 2494            <key>RunAtLoad</key>
  2508. 2495            <true/>
  2509. 2496            <key>SteamContentPaths</key>
  2510. 2497            <array>
  2511. 2498                    <string>/Users/USER/Library/Application Support/Steam/SteamApps</string>
  2512. 2499            </array>
  2513. 2500            <key>ThrottleInterval</key>
  2514. 2501            <integer>60</integer>
  2515. 2502            <key>WatchPaths</key>
  2516. 2503            <array>
  2517. 2504                    <string>/Applications/Steam.app</string>
  2518. 2505            </array>
  2519. 2506  
  2520. 2507      ...and 2 more line(s)
  2521. 2508  
  2522. 2509  User login items
  2523. 2510  
  2524. 2511      Bartender 2
  2525. 2512      -     /Applications/Bartender 2.app
  2526. 2513      iTunesHelper
  2527. 2514      -     /Applications/iTunes.app/Contents/MacOS/iTunesHelper.app
  2528. 2515      SABnzbd
  2529. 2516      -     /Applications/SABnzbd.app
  2530. 2517      WePrint Server
  2531. 2518      -     /Applications/WePrint Server.app
  2532. 2519      WDDriveUtilityHelper
  2533. 2520      -     /Applications/WD Drive Utilities.app/Contents/WDDriveUtilityHelper.app
  2534. 2521      SaneDesk
  2535. 2522      -     /Applications/SaneDesk.app
  2536. 2523      witchdaemon
  2537. 2524      -     /Library/PreferencePanes/Witch.prefPane/Contents/Helpers/witchdaemon.app
  2538. 2525      Butler
  2539. 2526      -     /Applications/Butler.app
  2540. 2527      VLCStreamer
  2541. 2528      -     /Applications/VLCStreamer.app
  2542. 2529      iBetterCharge
  2543. 2530      -     /Applications/iBetterCharge.app
  2544. 2531      Boom 2
  2545. 2532      -     /Applications/Boom 2.app
  2546. 2533      Dropbox
  2547. 2534      -     /Applications/Dropbox.app
  2548. 2535      Todoist
  2549. 2536      -     /Applications/Todoist.app
  2550. 2537      Music Manager
  2551. 2538      -     /Users/USER/Library/PreferencePanes/MusicManager.prefPane/Contents/Helpers/MusicManagerHelper.app
  2552. 2539      MagicMenu
  2553. 2540      -     /Applications/StuffIt Archive Manager.app/Contents/MacOS/MagicMenu.app
  2554. 2541      GoodSync
  2555. 2542      -     /Applications/GoodSync.app
  2556. 2543      Screens Connect
  2557. 2544      -     /Library/PreferencePanes/Screens Connect.prefPane/Contents/MacOS/Screens Connect.app
  2558. 2545      Amphetamine
  2559. 2546      -     /Applications/Amphetamine.app
  2560. 2547      LaunchBar
  2561. 2548      -     /Applications/LaunchBar.app
  2562. 2549      cDock-Agent
  2563. 2550      -     /Applications/cDock.app/Contents/Resources/cDock-Agent.app
  2564. 2551      Typinator
  2565. 2552      -     /Applications/Typinator.app
  2566. 2553      HazelHelper
  2567. 2554      -     /Library/PreferencePanes/Hazel.prefPane/Contents/MacOS/HazelHelper.app
  2568. 2555      Plex Media Server
  2569. 2556      -     /Applications/Plex Media Server.app
  2570. 2557      Command-C
  2571. 2558      -     /Applications/Command-C.app
  2572. 2559      GhostNote
  2573. 2560      -     /Applications/GhostNote.app
  2574. 2561      Hocus Focus
  2575. 2562      -     /Applications/Hocus Focus.app
  2576. 2563  
  2577. 2564  User crontab
  2578. 2565  
  2579. 2566      MAILTO=""
  2580. 2567  
  2581. 2568  Safari extensions
  2582. 2569  
  2583. 2570      1Password
  2584. 2571      -     com.agilebits.onepassword4-safari
  2585. 2572      Adblock Plus
  2586. 2573      -     org.adblockplus.adblockplussafari
  2587. 2574      Add To Amazon Wish List
  2588. 2575      -     com.amazon.safari.wishlist
  2589. 2576      Boomerang for Gmail
  2590. 2577      -     com.Baydin.b4gsafari
  2591. 2578      Clip to DEVONthink
  2592. 2579      -     com.devon-technologies.think.clip
  2593. 2580      comicSansBeGone
  2594. 2581      -     com.sitharus.comicsansbegone
  2595. 2582      CouchPotato
  2596. 2583      -     couchpotato.extension
  2597. 2584      Dragon
  2598. 2585      -     com.nuance.safari.dgnria
  2599. 2586      Facebook Cleaner
  2600. 2587      -     com.sonstermedia.facebookclean
  2601. 2588      Folx
  2602. 2589      -     com.eltima.Folx3extension
  2603. 2590      Google Analytics Opt-out Browser Add-on
  2604. 2591      -     com.google.AnalyticsOptOutSafariExtension.en
  2605. 2592      Grammarly Spell Checker & Grammar Checker
  2606. 2593      -     com.safari.grammarlyspellcheckergrammarcheckerUUID
  2607. 2594      InvisibleHand
  2608. 2595      -     com.forward.invisiblehand
  2609. 2596      Make It Short
  2610. 2597      -     com.junecloud.makeitshort
  2611. 2598      musicbox
  2612. 2599      -     com.tastyapps.musicbox.safariextz
  2613. 2600      Pins Extension
  2614. 2601      -     com.objectivesheep.pinsextension
  2615. 2602      PriceBlink
  2616. 2603      -     com.priceblink
  2617. 2604      Print Plus
  2618. 2605      -     com.slicefactory.printplus
  2619. 2606      Pushbullet
  2620. 2607      -     it.fancypixel.pushbullet
  2621. 2608      Save to Pocket
  2622. 2609      -     com.ideashower.pocket.safari
  2623. 2610      Social Fixer
  2624. 2611      -     com.socialfixer
  2625. 2612      Ultimate Status Bar
  2626. 2613      -     com.interclue.ultimatestatusbar
  2627. 2614      UTM Stripper
  2628. 2615      -     com.dosburros.safari-utm-stripper
  2629. 2616      Videobox
  2630. 2617      -     com.tastyapps.videobox.safariextz
  2631. 2618      Web Snapper
  2632. 2619      -     com.tastyapps.websnapper.safariextz
  2633. 2620      WOT
  2634. 2621      -     com.wotservicesoy.wot
  2635. 2622  
  2636. 2623  Firefox extensions
  2637. 2624  
  2638. 2625      Snagit Autoscroll Helper
  2639. 2626      nzbdStatus
  2640. 2627      Universal Print
  2641. 2628      United States English Spellchecker
  2642. 2629      Ĉapelisto
  2643. 2630      Amazon Add to Wish List Button
  2644. 2631      Click&Clean
  2645. 2632      BetterPrivacy
  2646. 2633      Lightbeam for Firefox
  2647. 2634      Esperanto Language Pack
  2648. 2635      Esperanta Vortaro
  2649. 2636      Markdown Here
  2650. 2637      Folx
  2651. 2638      The Amazon 1Button App for Firefox
  2652. 2639      CouchPotato
  2653. 2640      Clip to DEVONthink
  2654. 2641      Disconnect Search
  2655. 2642      Pins
  2656. 2643      Todoist
  2657. 2644      Print Edit
  2658. 2645      Disconnect
  2659. 2646      Adblock Plus
  2660. 2647      traduku
  2661. 2648  
  2662. 2649  Prefetching: Off
  2663. 2650  
  2664. 2651  Widgets
  2665. 2652  
  2666. 2653      Prowler
  2667. 2654  
  2668. 2655  iCloud errors
  2669. 2656  
  2670. 2657      bird  99
  2671. 2658      backupd       28
  2672. 2659      cloudd        27
  2673. 2660      Safari        19
  2674. 2661      Command-C     8
  2675. 2662      CallHistorySyncHelper 8
  2676. 2663      Deliveries    5
  2677. 2664      cloudphotosd  4
  2678. 2665      Finder        4
  2679. 2666      comapple.InputMethodKit.TextReplacementService        3
  2680. 2667      accountsd     3
  2681. 2668      comapple.ncplugin.weather     2
  2682. 2669      DeliveriesToday       2
  2683. 2670      comapple.appkit.xpc.openAndSavePanelService   1
  2684. 2671      TextEdit      1
  2685. 2672      Airmail 2     1
  2686. 2673  
  2687. 2674  Continuity errors
  2688. 2675  
  2689. 2676      sharedfilelistd       89
  2690. 2677      sharingd      8
  2691. 2678  
  2692. 2679  User caches/logs
  2693. 2680  
  2694. 2681      3.8 GiB: Library/Containers/com.apple.iBooksX/Data/Library/Caches/com.apple.iBooksX/ic-BKLibraryImageSource-2.cache
  2695. 2682  
  2696. 2683  Restricted files: 567
  2697. 2684  
  2698. 2685  Lockfiles: 2
  2699. 2686  
  2700. 2687  Global prefs (user)
  2701. 2688  
  2702. 2689      "UUID" = <70646674 6f6f6c6b 70646674 6f6f6c69 70646674 6f6f6c74 03000000 745a5546 65426679 46434a4d 74476d67 48464b58 00000000 00000000 00000000 00000000 00000000>
  2703. 2690      AppleEdgeResizeExteriorSize = 10
  2704. 2691      AppleTextBreakLocale = "en_US_POSIX"
  2705. 2692      CGInsertionPtAnimation = 1442657408
  2706. 2693      NSAppSleepDisabled = 1
  2707. 2694      NSCloseAlwaysConfirmsChanges = 1
  2708. 2695      NSFullScreenDarkMenu = 1
  2709. 2696      NSQuitAlwaysKeepsWindows = 1
  2710. 2697      NSRecentDocumentsLimit = 10
  2711. 2698      NSSavePanelStandardDesktopShortcutOnly = 1
  2712. 2699      QLEnableTextSelection = 1
  2713. 2700      WebAutomaticDashSubstitutionEnabled = 1
  2714. 2701      "com.maintain.cocktail" = UUID
  2715. 2702  
  2716. 2703  Data packages
  2717. 2704  
  2718. 2705      /Users/USER/Library/Mail/Bundles/Face2Face.mailbundle
  2719. 2706      /Users/USER/Library/Mail/Bundles/CargoLifter.mailbundle
  2720. 2707      /Users/USER/Library/Mail/Bundles (Disabled 9)/SendLater.mailbundle
  2721. 2708      /Users/USER/Library/Mail/Bundles (Disabled 9)/Face2Face.mailbundle
  2722. 2709      /Users/USER/Library/Mail/Bundles (Disabled 9)/Graffiti.mailbundle
  2723. 2710      /Users/USER/Library/Mail/Bundles (Disabled 9)/CargoLifter.mailbundle
  2724. 2711      /Users/USER/Library/Mail/Bundles (Disabled 3)/SendLater.mailbundle
  2725. 2712      /Users/USER/Library/Mail/Bundles (Disabled 12)/EverMail.mailbundle
  2726. 2713      /Users/USER/Library/Mail/Bundles (Disabled 12)/Graffiti.mailbundle
  2727. 2714      /Users/USER/Library/Mail/Bundles (Disabled 12)/SendLater.mailbundle
  2728. 2715      /Users/USER/Library/Mail/Bundles (Disabled 3)/CargoLifter.mailbundle
  2729. 2716      /Users/USER/Library/Mail/Bundles (Disabled 2)/Graffiti.mailbundle
  2730. 2717      /Users/USER/Library/Mail/Bundles (Disabled 2)/Face2Face.mailbundle
  2731. 2718      /Users/USER/Library/Mail/Bundles (Disabled 1)/Face2Face.mailbundle
  2732. 2719      /Users/USER/Library/Application Support/SendLater/SendLater 1562/SendLater.mailbundle
  2733. 2720      /Users/USER/Library/Application Support/iWeb/Domain.sites2
  2734. 2721      /Users/USER/Library/Application Support/Face2Face/Face2Face 1231/Face2Face.mailbundle
  2735. 2722      /Users/USER/Library/Application Support/CargoLifter/CargoLifter 2025/CargoLifter.mailbundle
  2736. 2723      /Users/USER/Library/Application Support/CargoLifter/CargoLifter 2024/CargoLifter.mailbundle
  2737. 2724  
  2738. 2725  Extensions
  2739. 2726  
  2740. 2727      /Library/Extensions/Boom2Device.kext
  2741. 2728      -     com.globaldelight.driver.Boom2Device
  2742. 2729      /Library/Extensions/LittleSnitch.kext
  2743. 2730      -     at.obdev.nke.LittleSnitch
  2744. 2731      /Library/Extensions/TACC.kext
  2745. 2732      -     com.techsmith.TACC
  2746. 2733      /Library/Extensions/klif.kext
  2747. 2734      -     com.kaspersky.kext.klif
  2748. 2735      /Library/Extensions/klnke.kext
  2749. 2736      -     com.kaspersky.nke
  2750. 2737      /Library/Extensions/tap.kext
  2751. 2738      -     foo.tap
  2752. 2739      /Library/Extensions/tun.kext
  2753. 2740      -     foo.tun
  2754. 2741      /Library/Extensions/ufsd_NTFS.kext
  2755. 2742      -     com.paragon-software.filesystems.ntfs
  2756. 2743      /System/Library/Extensions/AmbrosiaAudioSupport.kext
  2757. 2744      -     com.AmbrosiaSW.AudioSupport
  2758. 2745      /System/Library/Extensions/ElmediaPlayer.kext
  2759. 2746      -     com.eltima.ElmediaPlayer.kext
  2760. 2747      /System/Library/Extensions/JMicronATA.kext
  2761. 2748      -     com.jmicron.JMicronATA
  2762. 2749      /System/Library/Extensions/NoZAP-PL2303-10.9.kext
  2763. 2750      -     NoZAP.Driver-PL2303
  2764. 2751      /System/Library/Extensions/ProlificUsbSerial.kext
  2765. 2752      -     com.prolific.driver.PL2303
  2766. 2753      /System/Library/Extensions/SRXDisplayCard.kext
  2767. 2754      -     com.splashtop.driver.SRXDisplayCard
  2768. 2755      /System/Library/Extensions/SRXFrameBufferConnector.kext
  2769. 2756      -     com.splashtop.driver.SRXFrameBufferConnector
  2770. 2757      /System/Library/Extensions/Soundflower.kext
  2771. 2758      -     com.Cycling74.driver.Soundflower
  2772. 2759      /System/Library/Extensions/WD1394_64_109HPDriver.kext
  2773. 2760      -     com.wdc.driver.1394.64.10.9
  2774. 2761      /System/Library/Extensions/WDUSB_64_109HPDriver.kext
  2775. 2762      -     com.wdc.driver.USB.64.10.9
  2776. 2763      /System/Library/Extensions/hp_Inkjet3_io_enabler.kext
  2777. 2764      -     com.hp.print.hpio.Inkjet3.kext
  2778. 2765      /System/Library/Extensions/hp_fax_io.kext
  2779. 2766      -     com.hp.kext.hp-fax-io
  2780. 2767      /System/Library/Extensions/klif.kext
  2781. 2768      -     com.kaspersky.kext.klif
  2782. 2769      /System/Library/Extensions/klnke.kext
  2783. 2770      -     com.kaspersky.nke
  2784. 2771      /System/Library/Extensions/osx-pl2303.kext
  2785. 2772      -     nl.bjaelectronics.driver.PL2303
  2786. 2773  
  2787. 2774  Applications
  2788. 2775  
  2789. 2776      /Applications/Aegisub.app
  2790. 2777      -     com.aegisub.aegisub
  2791. 2778      /Applications/Braid.app
  2792. 2779      -     N/A
  2793. 2780      /Applications/Candy Apple.app
  2794. 2781      -     com.128bittech.CandyApple
  2795. 2782      /Applications/Cisdem PDFToolkit.app
  2796. 2783      -     com.cisdem.pdftoolkit
  2797. 2784      /Applications/CouchPotato.app
  2798. 2785      -     org.pythonmac.unspecified.CouchPotato
  2799. 2786      /Applications/CrossOver.app
  2800. 2787      -     N/A
  2801. 2788      /Applications/Deeper.app
  2802. 2789      -     com.titanium.Deeper
  2803. 2790      /Applications/Fluke.app
  2804. 2791      -     com.kichenko.fluke
  2805. 2792      /Applications/FreeMind.app
  2806. 2793      -     freemind.main.FreeMind
  2807. 2794      /Applications/Games/Analogue.app
  2808. 2795      -     org.renpy.launcher
  2809. 2796      /Applications/Games/Angband/Angband.app
  2810. 2797      -     org.rephial.angband
  2811. 2798      /Applications/Games/Angband/FAangband.app
  2812. 2799      -     N/A
  2813. 2800      /Applications/Games/Aquaria.app
  2814. 2801      -     com.bit-blot.aquaria
  2815. 2802      /Applications/Games/Avadon - The Black Fortress ƒ/Avadon v1.0.4.app
  2816. 2803      -     com.spiderwebsoftware.Avadon
  2817. 2804      /Applications/Games/Avernum - Escape From the Pit (Full Version)/Avernum v1.0.2.app
  2818. 2805      -     com.spiderwebsoftware.Avernum
  2819. 2806      /Applications/Games/Blades of Avernum ƒ/Blades of Avernum v1.2.1.app
  2820. 2807      -     com.SpiderwebSoftware.Blades of Avernum (Univ)
  2821. 2808      /Applications/Games/Geneforge v1.2 ƒ/Geneforge v1.2.app
  2822. 2809      -     com.yourcompany.Geneforge_Univ
  2823. 2810      /Applications/Games/Install Avadon (Full).app
  2824. 2811      -     com.MindVision.Installer
  2825. 2812      /Applications/Games/LongLiveTheQueen.app
  2826. 2813      -     org.renpy.launcher
  2827. 2814      /Applications/Games/Nethergate - Resurrection ƒ/Nethergate - Resurrection v1.0.3.app
  2828. 2815      -     com.SpiderwebSoftware.Nethergate
  2829. 2816      /Applications/Games/hateplus_mac/Hate Plus.app
  2830. 2817      -     org.renpy.launcher
  2831. 2818      /Applications/Games/hateplus_mac/game/hatoful.app
  2832. 2819      -     unity.Mediatonic.HatofulBoyfriend
  2833. 2820      /Applications/Gas Mask.app
  2834. 2821      -     ee.clockwise.gmask
  2835. 2822      /Applications/Get Lyrical.app
  2836. 2823      -     com.shullian.getlyrical
  2837. 2824      /Applications/GoPanda2.app
  2838. 2825      -     com.intel.nw
  2839. 2826      /Applications/HandBrake.app
  2840. 2827      -     fr.handbrake.HandBrake
  2841. 2828      /Applications/Hemingway.app
  2842. 2829      -     com.node-webkit-builder.hemingway
  2843. 2830      /Applications/Influent.app
  2844. 2831      -     unity.Three Flip Studios.Influent
  2845. 2832      /Applications/Jubler.app
  2846. 2833      -     com.panayotis.jubler
  2847. 2834      /Applications/Jutoh.app
  2848. 2835      -     uk.co.anthemion.jutoh
  2849. 2836      /Applications/MP4Joiner.app
  2850. 2837      -     org.mp4joiner.MP4Joiner
  2851. 2838      /Applications/Messenger.app
  2852. 2839      -     com.marcojetson.Messenger
  2853. 2840      /Applications/Microsoft Office 2011/Office/Add-Ins/Solver.app
  2854. 2841      -     com.microsoft.ASApplication
  2855. 2842      /Applications/Microsoft Office 2011/Office/Equation Editor.app
  2856. 2843      -     com.microsoft.EquationEditor
  2857. 2844      /Applications/Microsoft Office 2011/Office/Microsoft Office Setup Assistant.app
  2858. 2845      -     com.microsoft.office.setupassistant
  2859. 2846      /Applications/Microsoft Office 2011/Office/Microsoft Query.app
  2860. 2847      -     com.microsoft.Query
  2861. 2848      /Applications/OnyX.app
  2862. 2849      -     com.titanium.OnyX
  2863. 2850      /Applications/OpenDNS Updater.app
  2864. 2851      -     com.opendns.OpenDNS_Updater
  2865. 2852      /Applications/OpenOffice.app
  2866. 2853      -     org.openoffice.script
  2867. 2854      /Applications/OverDrive Media Console.app
  2868. 2855      -     com.overdrive.overdrivemediaconsole
  2869. 2856      /Applications/Pandora.app
  2870. 2857      -     com.pandora.desktop.UUID.1
  2871. 2858      /Applications/PhotoMill X.app
  2872. 2859      -     N/A
  2873. 2860      /Applications/Proview.app
  2874. 2861      -     com.coherentpdf.proview
  2875. 2862      /Applications/Python 2.7/Python Launcher.app
  2876. 2863      -     org.python.PythonLauncher
  2877. 2864      /Applications/RDMPlusDesktop.app
  2878. 2865      -     com.shapeservices.rdm.rdmplusdesktopmac
  2879. 2866      /Applications/Remote Desktop Connection.app
  2880. 2867      -     com.microsoft.rdc
  2881. 2868      /Applications/SixtyFour.app
  2882. 2869      -     com.1951FDG.SixtyFour
  2883. 2870      /Applications/SixtyFour.app/Contents/Applications/ProcessTimer.app
  2884. 2871      -     com.1951FDG.ProcessTimer
  2885. 2872      /Applications/Skim.app
  2886. 2873      -     net.sourceforge.skim-app.skim
  2887. 2874      /Applications/SlickVPN.app
  2888. 2875      -     org.pythonmac.unspecified.SlickVPN
  2889. 2876      /Applications/Subler.app
  2890. 2877      -     org.galad.Subler
  2891. 2878      /Applications/TeX/BibDesk.app
  2892. 2879      -     edu.ucsd.cs.mmccrack.bibdesk
  2893. 2880      /Applications/TeX/Excalibur-4.0.7/Excalibur.app
  2894. 2881      -     edu.bucknell.Excalibur
  2895. 2882      /Applications/TeX/LaTeXiT.app
  2896. 2883      -     fr.chachatelier.pierre.LaTeXiT
  2897. 2884      /Applications/TeX/SimpleTeX4ht.app
  2898. 2885      -     N/A
  2899. 2886      /Applications/TeX/TeX Live Utility.app
  2900. 2887      -     com.googlecode.mactlmgr.tlu
  2901. 2888      /Applications/TeX/texmaker.app
  2902. 2889      -     texmaker
  2903. 2890      /Applications/Text editing/Sigil.app
  2904. 2891      -     N/A
  2905. 2892      /Applications/Tor Messenger.app
  2906. 2893      -     org.instantbird
  2907. 2894      /Applications/TorBrowser.app
  2908. 2895      -     org.mozilla.tor browser
  2909. 2896      /Applications/Utilities/Adobe AIR Application Installer.app
  2910. 2897      -     com.adobe.air.ApplicationInstaller
  2911. 2898      /Applications/Utilities/Adobe AIR Uninstaller.app
  2912. 2899      -     com.adobe.air.Installer
  2913. 2900      /Applications/Utilities/Stuffit Extras/Sample Droplets/Attach a ZIP archive to an email.app
  2914. 2901      -     com.stuffit.droplet.UUID
  2915. 2902      /Applications/Utilities/Stuffit Extras/Sample Droplets/Attach an encrypted ZIP archive to an email.app
  2916. 2903      -     com.stuffit.droplet.UUID
  2917. 2904      /Applications/Utilities/Stuffit Extras/Sample Droplets/Burn a StuffIt X archive to CD or DVD.app
  2918. 2905      -     com.stuffit.droplet.UUID
  2919. 2906      /Applications/Utilities/Stuffit Extras/Sample Droplets/Create a DMG of files (no compression).app
  2920. 2907      -     com.stuffit.droplet.UUID
  2921. 2908      /Applications/Utilities/Stuffit Extras/Sample Droplets/Create an encrypted ZIP archive and prompt for Destination.app
  2922. 2909      -     com.stuffit.droplet.UUID
  2923. 2910      /Applications/Utilities/Stuffit Extras/Sample Droplets/Expand an archive - delete archive when done.app
  2924. 2911      -     com.stuffit.droplet.UUID
  2925. 2912      /Applications/WeNotify.app
  2926. 2913      -     com.eurosmartz.macpushpublic
  2927. 2914      /Applications/WePrint Server.app
  2928. 2915      -     com.eurosmartz.mobile.printserver
  2929. 2916      /Applications/WhiteNoiseCreator.app
  2930. 2917      -     com.tmsoft.mac.WhiteNoiseCreator
  2931. 2918      /Applications/XLD.app
  2932. 2919      -     jp.tmkk.XLD
  2933. 2920      /Applications/cDock.app
  2934. 2921      -     org.w0lf.cDock-GUI
  2935. 2922      /Applications/cocoaDialog.app
  2936. 2923      -     com.cocoaDialog
  2937. 2924      /Applications/iFunBox.app
  2938. 2925      -     com.iFunBoxDevTeam.iFunBox
  2939. 2926      /Applications/kid3.app
  2940. 2927      -     net.sourceforge.kid3
  2941. 2928      /Applications/kurso4.app
  2942. 2929      -     com.yourcompany.kurso4
  2943. 2930      /Applications/terminal-notifier.app
  2944. 2931      -     nl.superalloy.oss.terminal-notifier
  2945. 2932      /Library/Application Support/Dragon/Speech Engine Data (English) 4.0.app
  2946. 2933      -     com.dragon.Speech_Engine_Data__English__4_0
  2947. 2934      /Library/Application Support/Dragon/Speech Engine Data v3.app
  2948. 2935      -     com.dragon.Speech_Engine_Data_v3
  2949. 2936      /Library/Application Support/Microsoft/MERP2.0/Microsoft Error Reporting.app
  2950. 2937      -     com.microsoft.error_reporting
  2951. 2938      /Library/Application Support/Microsoft/MERP2.0/Microsoft Ship Asserts.app
  2952. 2939      -     com.microsoft.netlib.shipassertprocess
  2953. 2940      /Library/Application Support/Microsoft/Silverlight/OutOfBrowser/SLLauncher.app
  2954. 2941      -     com.microsoft.silverlight.sllauncher
  2955. 2942      /Library/Application Support/iGlasses3/iGlasses.app
  2956. 2943      -     com.ecamm.iGlassesAgent
  2957. 2944      /Library/Frameworks/Adobe AIR.framework/Versions/1.0/Adobe AIR Application Installer.app
  2958. 2945      -     com.adobe.air.ApplicationInstaller
  2959. 2946      /Library/Frameworks/Adobe AIR.framework/Versions/1.0/Resources/Adobe AIR Updater.app
  2960. 2947      -     com.adobe.air.Installer
  2961. 2948      /Library/Frameworks/Tk.framework/Versions/8.6/Resources/Wish.app
  2962. 2949      -     com.tcltk.wish
  2963. 2950      /Library/Ruby/Gems/2.0.0/gems/terminal-notifier-1.6.2/vendor/terminal-notifier/terminal-notifier.app
  2964. 2951      -     nl.superalloy.oss.terminal-notifier
  2965. 2952      /Library/Ruby/Gems/2.0.0/gems/terminal-notifier-1.6.3/vendor/terminal-notifier/terminal-notifier.app
  2966. 2953      -     nl.superalloy.oss.terminal-notifier
  2967. 2954      /Library/Services/GPGServices.service
  2968. 2955      -     org.gpgtools.gpgservices
  2969. 2956      /Users/USER/Applications/Chrome Apps.localized/Profile 1 apdfllckaahabafndbhieahigkjlhalf.app
  2970. 2957      -     com.google.Chrome.app.Profile-1-apdfllckaahabafndbhieahigkjlhalf
  2971. 2958      /Users/USER/Applications/Chrome Apps.localized/Profile 1 blpcfgokakmgnkcojhhkbfbldkacnbeo.app
  2972. 2959      -     com.google.Chrome.app.Profile-1-blpcfgokakmgnkcojhhkbfbldkacnbeo
  2973. 2960      /Users/USER/Applications/Chrome Apps.localized/Profile 1 coobgpohoikkiipiblmjeljniedjpjpf.app
  2974. 2961      -     com.google.Chrome.app.Profile-1-coobgpohoikkiipiblmjeljniedjpjpf
  2975. 2962      /Users/USER/Applications/Chrome Apps.localized/Profile 1 kcfoblhpibkgaolddkdakldhfpjfjgod.app
  2976. 2963      -     com.google.Chrome.app.Profile-1-kcfoblhpibkgaolddkdakldhfpjfjgod
  2977. 2964      /Users/USER/Applications/Chrome Apps.localized/Profile 1 pjkljhegncpnkpknbcohdijeoejaedia.app
  2978. 2965      -     com.google.Chrome.app.Profile-1-pjkljhegncpnkpknbcohdijeoejaedia
  2979. 2966      /Users/USER/Applications/CrossOver/CrossOver Explorer.app
  2980. 2967      -     com.codeweavers.CrossOverHelper.UUID.UUID
  2981. 2968      /Users/USER/Applications/CrossOver/My Girlfriend is the President/My Girlfriend is the President on the Web.app
  2982. 2969      -     com.codeweavers.CrossOverHelper.UUID.UUID
  2983. 2970      /Users/USER/Applications/CrossOver/My Girlfriend is the President/My Girlfriend is the President.app
  2984. 2971      -     com.codeweavers.CrossOverHelper.UUID.UUID
  2985. 2972      /Users/USER/Applications/CrossOver/My Girlfriend is the President/Uninstall My Girlfriend is the President.app
  2986. 2973      -     com.codeweavers.CrossOverHelper.UUID.UUID
  2987. 2974      /Users/USER/Applications/Seduce Me.app
  2988. 2975      -     unity.No Reply Games.Seduce Me
  2989. 2976      /Users/USER/Downloads/SIMBL-0.9.9/SIMBL Uninstaller.app
  2990. 2977      -     org.mike.SIMBLUninstaller
  2991. 2978      /Users/USER/Downloads/mmd-drag/MMD2HTML.app
  2992. 2979      -     net.fletcherpenney.MMD2HTML
  2993. 2980      /Users/USER/Downloads/mmd-drag/MMD2LaTeX.app
  2994. 2981      -     net.fletcherpenney.MMD2LaTeX
  2995. 2982      /Users/USER/Downloads/mmd-drag/MMD2ODF.app
  2996. 2983      -     net.fletcherpenney.MMD2ODF
  2997. 2984      /Users/USER/Downloads/mmd-drag/MMD2PDF.app
  2998. 2985      -     net.fletcherpenney.MMD2PDF
  2999. 2986      /Users/USER/Downloads/mmd-drag/MMD2RTF.app
  3000. 2987      -     net.fletcherpenney.MMD2RTF
  3001. 2988      /Users/USER/Dropbox/Alfred/Alfred.alfredpreferences/workflows/user.workflow.UUID/resources/DummyAppForGrowl.app
  3002. 2989      -     N/A
  3003. 2990      /Users/USER/Library/Application Support/CrossOver/Helpers/CrossOver Helper (CrossOver HTML engine (IE 8.0 mode)).app
  3004. 2991      -     com.codeweavers.CrossOverHelper.CrossOverUUID/
  3005. 2992      /Users/USER/Library/Application Support/Eltima Software/Folx3/FolxAgent.app
  3006. 2993      -     com.eltima.FolxAgent
  3007. 2994      /Users/USER/Library/Application Support/Facebook/video/1.2.0.158/FacebookVideoCalling.app
  3008. 2995      -     com.Skype.FacebookVideoCalling
  3009. 2996      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_aohghmighlieiainnegkcijnfilokake/Default aohghmighlieiainnegkcijnfilokake.app
  3010. 2997      -     com.google.Chrome.app.Default-aohghmighlieiainnegkcijnfilokake-internal
  3011. 2998      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_apdfllckaahabafndbhieahigkjlhalf/Default apdfllckaahabafndbhieahigkjlhalf.app
  3012. 2999      -     com.google.Chrome.app.Default-apdfllckaahabafndbhieahigkjlhalf-internal
  3013. 3000      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_blpcfgokakmgnkcojhhkbfbldkacnbeo/Default blpcfgokakmgnkcojhhkbfbldkacnbeo.app
  3014. 3001      -     com.google.Chrome.app.Default-blpcfgokakmgnkcojhhkbfbldkacnbeo-internal
  3015. 3002      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_coobgpohoikkiipiblmjeljniedjpjpf/Default coobgpohoikkiipiblmjeljniedjpjpf.app
  3016. 3003      -     com.google.Chrome.app.Default-coobgpohoikkiipiblmjeljniedjpjpf-internal
  3017. 3004      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_ejjicmeblgpmajnghnpcppodonldlgfn/Default ejjicmeblgpmajnghnpcppodonldlgfn.app
  3018. 3005      -     com.google.Chrome.app.Default-ejjicmeblgpmajnghnpcppodonldlgfn-internal
  3019. 3006      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_fkkaebihfmbofclegkcfkkemepfehibg/Default fkkaebihfmbofclegkcfkkemepfehibg.app
  3020. 3007      -     com.google.Chrome.app.Default-fkkaebihfmbofclegkcfkkemepfehibg-internal
  3021. 3008      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_hbdpomandigafcibbmofojjchbcdagbl/Default hbdpomandigafcibbmofojjchbcdagbl.app
  3022. 3009      -     com.google.Chrome.app.Default-hbdpomandigafcibbmofojjchbcdagbl-internal
  3023. 3010      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_icmaknaampgiegkcjlimdiidlhopknpk/Default icmaknaampgiegkcjlimdiidlhopknpk.app
  3024. 3011      -     com.google.Chrome.app.Default-icmaknaampgiegkcjlimdiidlhopknpk-internal
  3025. 3012      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_ioekoebejdcmnlefjiknokhhafglcjdl/Default ioekoebejdcmnlefjiknokhhafglcjdl.app
  3026. 3013      -     com.google.Chrome.app.Default-ioekoebejdcmnlefjiknokhhafglcjdl-internal
  3027. 3014      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_lneaknkopdijkpnocmklfnjbeapigfbh/Default lneaknkopdijkpnocmklfnjbeapigfbh.app
  3028. 3015      -     com.google.Chrome.app.Default-lneaknkopdijkpnocmklfnjbeapigfbh-internal
  3029. 3016      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_mmimngoggfoobjdlefbcabngfnmieonb/Default mmimngoggfoobjdlefbcabngfnmieonb.app
  3030. 3017      -     com.google.Chrome.app.Default-mmimngoggfoobjdlefbcabngfnmieonb-internal
  3031. 3018      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_nmmhkkegccagdldgiimedpiccmgmieda/Default nmmhkkegccagdldgiimedpiccmgmieda.app
  3032. 3019      -     com.google.Chrome.app.Default-nmmhkkegccagdldgiimedpiccmgmieda-internal
  3033. 3020      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_pdabfienifkbhoihedcgeogidfmibmhp/Default pdabfienifkbhoihedcgeogidfmibmhp.app
  3034. 3021      -     com.google.Chrome.app.Default-pdabfienifkbhoihedcgeogidfmibmhp-internal
  3035. 3022      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_pjejbgheonogbpfkkjigbmahaljipoej/Default pjejbgheonogbpfkkjigbmahaljipoej.app
  3036. 3023      -     com.google.Chrome.app.Default-pjejbgheonogbpfkkjigbmahaljipoej-internal
  3037. 3024      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_pjkljhegncpnkpknbcohdijeoejaedia/Default pjkljhegncpnkpknbcohdijeoejaedia.app
  3038. 3025      -     com.google.Chrome.app.Default-pjkljhegncpnkpknbcohdijeoejaedia-internal
  3039. 3026      /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_aohghmighlieiainnegkcijnfilokake/Profile 1 aohghmighlieiainnegkcijnfilokake.app
  3040. 3027      -     com.google.Chrome.app.Profile-1-aohghmighlieiainnegkcijnfilokake-internal
  3041. 3028      /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_apdfllckaahabafndbhieahigkjlhalf/Profile 1 apdfllckaahabafndbhieahigkjlhalf.app
  3042. 3029      -     com.google.Chrome.app.Profile-1-apdfllckaahabafndbhieahigkjlhalf-internal
  3043. 3030      /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_blpcfgokakmgnkcojhhkbfbldkacnbeo/Profile 1 blpcfgokakmgnkcojhhkbfbldkacnbeo.app
  3044. 3031      -     com.google.Chrome.app.Profile-1-blpcfgokakmgnkcojhhkbfbldkacnbeo-internal
  3045. 3032      /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_coobgpohoikkiipiblmjeljniedjpjpf/Profile 1 coobgpohoikkiipiblmjeljniedjpjpf.app
  3046. 3033      -     com.google.Chrome.app.Profile-1-coobgpohoikkiipiblmjeljniedjpjpf-internal
  3047. 3034      /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_kcfoblhpibkgaolddkdakldhfpjfjgod/Profile 1 kcfoblhpibkgaolddkdakldhfpjfjgod.app
  3048. 3035      -     com.google.Chrome.app.Profile-1-kcfoblhpibkgaolddkdakldhfpjfjgod-internal
  3049. 3036      /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_pjkljhegncpnkpknbcohdijeoejaedia/Profile 1 pjkljhegncpnkpknbcohdijeoejaedia.app
  3050. 3037      -     com.google.Chrome.app.Profile-1-pjkljhegncpnkpknbcohdijeoejaedia-internal
  3051. 3038      /Users/USER/Library/Application Support/MountainNotifier/EggTimer.app
  3052. 3039      -     NOTIFIER.EggTimer
  3053. 3040      /Users/USER/Library/Application Support/MountainNotifier/MountainNotifierTemplate.app
  3054. 3041      -     info.pich.MountainNotifierTemplate
  3055. 3042      /Users/USER/Library/Application Support/Steam/SteamApps/common/AI War Fleet Command/AIWar.app
  3056. 3043      -     unity.Arcen Games, LLC.AI War
  3057. 3044      /Users/USER/Library/Application Support/Steam/SteamApps/common/AI War Fleet Command/UDA/ArcenUpdater.app
  3058. 3045      -     unity.Arcen Games, LLC.Arcen Updater
  3059. 3046      /Users/USER/Library/Application Support/Steam/SteamApps/common/Bientot_l_ete/Bientôt l’été.app:̂t l’été:
  3060. 3047      -     N/A
  3061. 3048      /Users/USER/Library/Application Support/Steam/SteamApps/common/Duke Nukem 3D/bin/build.app
  3062. 3049      -     au.id.jonof.kenbuild.build
  3063. 3050      /Users/USER/Library/Application Support/Steam/SteamApps/common/Duke Nukem 3D/bin/duke3d.app
  3064. 3051      -     com.generalarcade.duke3d
  3065. 3052      /Users/USER/Library/Application Support/Steam/SteamApps/common/GoatSimulator/GoatSimulator.app
  3066. 3053      -     com.coffeestainstudios.goatsimulator
  3067. 3054      /Users/USER/Library/Application Support/Steam/SteamApps/common/Hacker Evolution Duality/HackerEvolutionDuality.app
  3068. 3055      -     com.exosyphen.heddeluxe
  3069. 3056      /Users/USER/Library/Application Support/Steam/SteamApps/common/Shadow Warrior Classic/bin/build.app
  3070. 3057      -     au.id.jonof.kenbuild.build
  3071. 3058      /Users/USER/Library/Application Support/Steam/SteamApps/common/Shadow Warrior Classic/bin/sw.app
  3072. 3059      -     com.generalarcade.sw
  3073. 3060      /Users/USER/Library/Mail/Bundles (Disabled 11)/DockStar.mailbundle/Contents/Resources/Software Update.app
  3074. 3061      -     com.creativeinaustria.DockStar.SoftwareUpdate
  3075. 3062      /Users/USER/Library/Mobile Documents/com~apple~Automator/Documents/Untitled 2.app
  3076. 3063      -     com.apple.automator.Untitled 2
  3077. 3064      /Users/USER/Library/Mobile Documents/com~apple~Automator/Documents/Untitled.app
  3078. 3065      -     com.apple.automator.Untitled
  3079. 3066      /Users/USER/Library/Printers/Officejet Pro 8500 A910 [D0C9AB].app
  3080. 3067      -     com.apple.print.PrinterProxy
  3081. 3068      /Users/USER/Library/Services/CalcService.service
  3082. 3069      -     org.grunenberg.CalcService
  3083. 3070      /Users/USER/Library/Services/NoteBookHelper.service
  3084. 3071      -     com.CircusPonies.NoteBookHelper
  3085. 3072      /Users/USER/Library/Services/OmniOutliner Professional.service
  3086. 3073      -     com.omnigroup.OmniOutlinerPro3.ClippingService
  3087. 3074      /Users/USER/Library/Workflows/Applications/Calendar/Sickbeard MP4 Automation (scheduled).app
  3088. 3075      -     com.apple.automator.Sickbeard MP4 Automation (scheduled)
  3089. 3076      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_aohghmighlieiainnegkcijnfilokake/Default aohghmighlieiainnegkcijnfilokake.app
  3090. 3077      -     com.google.Chrome.app.Default-aohghmighlieiainnegkcijnfilokake-internal
  3091. 3078      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_nmmhkkegccagdldgiimedpiccmgmieda/Default nmmhkkegccagdldgiimedpiccmgmieda.app
  3092. 3079      -     com.google.Chrome.app.Default-nmmhkkegccagdldgiimedpiccmgmieda-internal
  3093. 3080      /Users/USER/Library/Mobile Documents/com~apple~Automator/Documents/Untitled 2.app
  3094. 3081      -     com.apple.automator.Untitled 2
  3095. 3082      /Users/USER/Library/Mobile Documents/com~apple~Automator/Documents/Untitled.app
  3096. 3083      -     com.apple.automator.Untitled
  3097. 3084      /Users/USER/Applications/Chrome Apps.localized/Default coobgpohoikkiipiblmjeljniedjpjpf.app
  3098. 3085      -     com.google.Chrome.app.Default-coobgpohoikkiipiblmjeljniedjpjpf
  3099. 3086      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_blpcfgokakmgnkcojhhkbfbldkacnbeo/Default blpcfgokakmgnkcojhhkbfbldkacnbeo.app
  3100. 3087      -     com.google.Chrome.app.Default-blpcfgokakmgnkcojhhkbfbldkacnbeo-internal
  3101. 3088      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_coobgpohoikkiipiblmjeljniedjpjpf/Default coobgpohoikkiipiblmjeljniedjpjpf.app
  3102. 3089      -     com.google.Chrome.app.Default-coobgpohoikkiipiblmjeljniedjpjpf-internal
  3103. 3090      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_nmmhkkegccagdldgiimedpiccmgmieda/Default nmmhkkegccagdldgiimedpiccmgmieda.app
  3104. 3091      -     com.google.Chrome.app.Default-nmmhkkegccagdldgiimedpiccmgmieda-internal
  3105. 3092      /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_pjkljhegncpnkpknbcohdijeoejaedia/Default pjkljhegncpnkpknbcohdijeoejaedia.app
  3106. 3093      -     com.google.Chrome.app.Default-pjkljhegncpnkpknbcohdijeoejaedia-internal
  3107. 3094      /usr/local/Cellar/python/2.7.10_2/Frameworks/Python.framework/Versions/2.7/Resources/Python.app
  3108. 3095      -     org.python.python
  3109. 3096      /usr/local/Cellar/python/2.7.10_2/Python Launcher.app
  3110. 3097      -     org.python.PythonLauncher
  3111. 3098      /usr/local/Cellar/terminal-notifier/1.6.3/terminal-notifier.app
  3112. 3099      -     nl.superalloy.oss.terminal-notifier
  3113. 3100      /usr/local/git/share/git-gui/lib/Git Gui.app
  3114. 3101      -     cz.or.repo.git-gui
  3115. 3102  
  3116. 3103  Frameworks
  3117. 3104  
  3118. 3105      /Library/Frameworks/Adobe AIR.framework
  3119. 3106      -     com.adobe.AIR
  3120. 3107      /Library/Frameworks/IntegoiCalFramework.framework
  3121. 3108      -     N/A
  3122. 3109      /Library/Frameworks/Libmacgpg.framework
  3123. 3110      -     org.gpgtools.Libmacgpg
  3124. 3111      /Library/Frameworks/MacFUSE.framework
  3125. 3112      -     com.google.MacFUSE
  3126. 3113      /Library/Frameworks/Mono.framework
  3127. 3114      -     N/A
  3128. 3115      /Library/Frameworks/NetUpdateShared.framework
  3129. 3116      -     com.intego.NetUpdateShared
  3130. 3117      /Library/Frameworks/OSXFUSE.framework
  3131. 3118      -     com.github.osxfuse.framework
  3132. 3119      /Library/Frameworks/Tcl.framework
  3133. 3120      -     com.tcltk.tcllibrary
  3134. 3121      /Library/Frameworks/Tk.framework
  3135. 3122      -     com.tcltk.tklibrary
  3136. 3123      /Users/USER/Library/Frameworks/EWSMac.framework
  3137. 3124      -     com.eSellerate.EWSMac83886081
  3138. 3125  
  3139. 3126  PrefPane
  3140. 3127  
  3141. 3128      /Library/Internet Plug-Ins/JavaAppletPlugin.plugin/Contents/Home/lib/deploy/JavaControlPanel.prefPane
  3142. 3129      -     com.oracle.java.JavaControlPanel
  3143. 3130      /Library/PreferencePanes/Flash Player.prefPane
  3144. 3131      -     com.adobe.flashplayerpreferences
  3145. 3132      /Library/PreferencePanes/Hazel.prefPane
  3146. 3133      -     com.noodlesoft.Hazel
  3147. 3134      /Library/PreferencePanes/LocalTeX.prefPane
  3148. 3135      -     com.eugenealgorithms.LocalTeX
  3149. 3136      /Library/PreferencePanes/OSXFUSE.prefPane
  3150. 3137      -     com.github.osxfuse.OSXFUSEPrefPane
  3151. 3138      /Library/PreferencePanes/ParagonNTFS.prefPane:® OS X:
  3152. 3139      -     N/A
  3153. 3140      /Library/PreferencePanes/RedHand.prefPane
  3154. 3141      -     com.soma-zone.RedHandPreferences
  3155. 3142      /Library/PreferencePanes/Screens Connect.prefPane
  3156. 3143      -     com.edovia.screens.connect.mac
  3157. 3144      /Library/PreferencePanes/Spelling.prefPane
  3158. 3145      -     net.leuski.cocoaspell.Spelling
  3159. 3146      /Library/PreferencePanes/TeXDistPrefPane.prefPane
  3160. 3147      -     comp.text.tex.distribution.preference
  3161. 3148      /Library/PreferencePanes/Witch.prefPane
  3162. 3149      -     com.manytricks.Witch
  3163. 3150      /Users/USER/Library/PreferencePanes/Default Folder X.prefPane
  3164. 3151      -     com.stclairsoft.prefpane.DefaultFolderX
  3165. 3152      /Users/USER/Library/PreferencePanes/GPGPreferences.prefPane
  3166. 3153      -     org.gpgtools.gpgpreferences
  3167. 3154      /Users/USER/Library/PreferencePanes/MusicManager.prefPane
  3168. 3155      -     com.google.musicmanager.pref
  3169. 3156      /Users/USER/Library/PreferencePanes/Printopia.prefPane
  3170. 3157      -     com.ecamm.printopia
  3171. 3158  
  3172. 3159  Bundles
  3173. 3160  
  3174. 3161      /Library/Audio/Plug-Ins/HAL/BartenderAudioPlugIn.plugin
  3175. 3162      -     com.surteesstudios.BartenderAudioPlugIn
  3176. 3163      /Library/CoreMediaIO/Plug-Ins/DAL/iGlasses.plugin
  3177. 3164      -     com.ecamm.iGlasses3
  3178. 3165      /Library/CoreMediaIO/Plug-Ins/FCP-DAL/iGlasses.plugin
  3179. 3166      -     com.ecamm.iGlasses3
  3180. 3167      /Library/Frameworks/Adobe AIR.framework/Versions/1.0/Resources/AdobeCP15.plugin
  3181. 3168      -     com.adobe.adobecp
  3182. 3169      /Library/Frameworks/Adobe AIR.framework/Versions/1.0/Resources/Flash Player.plugin
  3183. 3170      -     com.macromedia.FlashPlayer-10.6.plugin
  3184. 3171      /Library/Internet Plug-Ins/Flash Player.plugin
  3185. 3172      -     com.macromedia.Flash Player.plugin
  3186. 3173      /Library/Internet Plug-Ins/JavaAppletPlugin.plugin
  3187. 3174      -     com.oracle.java.JavaAppletPlugin
  3188. 3175      /Library/Internet Plug-Ins/MeetingJoinPlugin.plugin
  3189. 3176      -     com.microsoft.communicator.meetingjoinplugin
  3190. 3177      /Library/Internet Plug-Ins/SharePointBrowserPlugin.plugin
  3191. 3178      -     com.microsoft.sharepoint.browserplugin
  3192. 3179      /Library/Internet Plug-Ins/Silverlight.plugin
  3193. 3180      -     com.microsoft.SilverlightPlugin
  3194. 3181      /Library/Internet Plug-Ins/googletalkbrowserplugin.plugin
  3195. 3182      -     com.google.googletalkbrowserplugin
  3196. 3183      /Library/Internet Plug-Ins/npDDRia.plugin
  3197. 3184      -     com.nuance.npDDRia
  3198. 3185      /Library/Internet Plug-Ins/o1dbrowserplugin.plugin
  3199. 3186      -     com.google.o1dbrowserplugin
  3200. 3187      /Library/Mail/Bundles/GPGMail.mailbundle
  3201. 3188      -     org.gpgtools.gpgmail
  3202. 3189      /Library/QuickLook/FreemindQL.qlgenerator
  3203. 3190      -     net.freemind.qlgenerator
  3204. 3191      /Library/Screen Savers/Electric Sheep.saver
  3205. 3192      -     org.electricsheep.ElectricSheep.saver
  3206. 3193      /Library/Spotlight/Wolfram Notebook.mdimporter
  3207. 3194      -     com.wolfram.mathematica.notebook.search.spotlight
  3208. 3195      /Library/Tundra/Plug-Ins/DAL/iGlasses3.plugin
  3209. 3196      -     com.ecamm.iGlasses3
  3210. 3197      /Users/USER/Downloads/MacTeXtras/Extras/Browsers/Symbols.wdgt
  3211. 3198      -     com.vocaro.widget.Symbols
  3212. 3199      /Users/USER/Downloads/MultiMarkdown QuickLook Generator/MultiMarkdownQuickLook.qlgenerator
  3213. 3200      -     net.fletcherpenney.quicklook
  3214. 3201      /Users/USER/Library/Address Book Plug-Ins/DeskConnect Plug-In.bundle
  3215. 3202      -     com.deskconnect.address-book-plugin
  3216. 3203      /Users/USER/Library/Address Book Plug-Ins/SkypeABCaller.bundle
  3217. 3204      -     com.skype.SkypeABCaller
  3218. 3205      /Users/USER/Library/Address Book Plug-Ins/SkypeABChatter.bundle
  3219. 3206      -     com.skype.SkypeABChatter
  3220. 3207      /Users/USER/Library/Address Book Plug-Ins/SkypeABDialer.bundle
  3221. 3208      -     com.skype.skypeabdialer
  3222. 3209      /Users/USER/Library/Address Book Plug-Ins/SkypeABSMS.bundle
  3223. 3210      -     com.skype.skypeabsms
  3224. 3211      /Users/USER/Library/Application Support/Eltima Software/Folx3/Folx3Plugin.plugin
  3225. 3212      -     com.eltima.Folx3.plugin
  3226. 3213      /Users/USER/Library/Application Support/Google/Chrome/PepperFlash/19.0.0.226/PepperFlashPlayer.plugin
  3227. 3214      -     com.macromedia.PepperFlashPlayer.pepper
  3228. 3215      /Users/USER/Library/Internet Plug-Ins/Box Edit.plugin
  3229. 3216      -     com.BoxEditLib.Box Edit
  3230. 3217      /Users/USER/Library/Internet Plug-Ins/CitrixOnlineWebDeploymentPlugin.plugin
  3231. 3218      -     com.citrixonline.mac.WebDeploymentPlugin
  3232. 3219      /Users/USER/Library/Spotlight/EndNote.mdimporter
  3233. 3220      -     com.ThomsonResearchSoft.EndNote
  3234. 3221      /Users/USER/Library/Spotlight/NoteBook.mdimporter
  3235. 3222      -     com.CircusPonies.NoteBook.mdimporter
  3236. 3223      /Users/USER/Library/Address Book Plug-Ins/SkypeABDialer.bundle
  3237. 3224      -     com.skype.skypeabdialer
  3238. 3225      /Users/USER/Library/Address Book Plug-Ins/SkypeABSMS.bundle
  3239. 3226      -     com.skype.skypeabsms
  3240. 3227      /Users/USER/Library/Application Support/Google/Chrome/PepperFlash/11.8.800.97/PepperFlashPlayer.plugin
  3241. 3228      -     com.macromedia.PepperFlashPlayer.pepper
  3242. 3229      /Users/USER/Library/Address Book Plug-Ins/SkypeABCaller.bundle
  3243. 3230      -     com.skype.SkypeABCaller
  3244. 3231      /Users/USER/Library/Address Book Plug-Ins/SkypeABChatter.bundle
  3245. 3232      -     com.skype.SkypeABChatter
  3246. 3233      /Users/USER/Library/Address Book Plug-Ins/SkypeABDialer.bundle
  3247. 3234      -     com.skype.skypeabdialer
  3248. 3235      /Users/USER/Library/Address Book Plug-Ins/SkypeABSMS.bundle
  3249. 3236      -     com.skype.skypeabsms
  3250. 3237      /Users/USER/Library/Application Support/Google/Chrome/PepperFlash/19.0.0.226/PepperFlashPlayer.plugin
  3251. 3238      -     com.macromedia.PepperFlashPlayer.pepper
  3252. 3239  
  3253. 3240  App extensions
  3254. 3241  
  3255. 3242      com.HobbyistSoftware.RightClick.RCPlugin
  3256. 3243      com.Monity.Widget
  3257. 3244      com.agilebits.onepassword-osx.safariextensioncompanion
  3258. 3245      com.crowdedroad.ifaxpromac.widget
  3259. 3246      com.dayoneapp.dayone.Day-One-Share-Extension
  3260. 3247      com.devon-technologies.think.share
  3261. 3248      com.flexibits.fantastical2.mac.action-extension
  3262. 3249      com.flexibits.fantastical2.mac.share-extension
  3263. 3250      com.flexibits.fantastical2.mac.today-widget
  3264. 3251      com.junecloud.mac.Deliveries.Add
  3265. 3252      com.junecloud.mac.Deliveries.Today
  3266. 3253      com.kachalobalashoff.iStudiez.Today
  3267. 3254      com.lifewareSolutions.DeluxeMoonProForMac.DeluxeMoonWidget
  3268. 3255      com.microsoft.onenote.mac.shareextension
  3269. 3256      com.pushbullet.macapp.Pushbullet-Share
  3270. 3257      com.readitlater.PocketMac.AddToPocketShareExtension
  3271. 3258      com.todoist.mac.Todoist.TodoistShare
  3272. 3259      com.todoist.mac.Todoist.TodoistToday
  3273. 3260      io.github.norio-nomura.CopyLatLngOnMaps.ShareExtension
  3274. 3261      it.bloop.airmail2.Airmail-Compose
  3275. 3262      it.bloop.airmail2.Airmail-Share
  3276. 3263      it.bloop.airmail2.Airmail-Today
  3277. 3264  
  3278. 3265  Modifications
  3279. 3266  
  3280. 3267      file added: /Applications/Adobe Digital Editions 4.0.app/Contents/MacOS/digitaleditions
  3281. 3268      file added: /Applications/Amazon Music.app/Contents/Frameworks/Amazon Music Helper.app
  3282. 3269      file added: /Applications/Amazon Music.app/Contents/Frameworks/cef/libcef.dylib
  3283. 3270      file added: /Applications/AudioBookBinder.app/Contents/MacOS/abbinder
  3284. 3271      file added: /Applications/AudioBookBinder.app/Contents/MacOS/AudioBookBinder.x86_64
  3285. 3272      file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Formats/Molecular Ecology
  3286. 3273      file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Formats/Annu Rev Neurosci
  3287. 3274      file missing: /Applications/Bookends.app/Contents/Resources/Toolbar_List2Active.png
  3288. 3275      file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/MIT
  3289. 3276      file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/BibTeX
  3290. 3277      file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/Glasgow U
  3291. 3278      file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/Fordham U
  3292. 3279      file missing: /Applications/Bookends.app/Contents/Resources/EMAIL
  3293. 3280      file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/Library of Congress
  3294. 3281      file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/Chinese U of Hong Kong
  3295. 3282      ...
  3296. 3283      file added: /Applications/DEVONsphere Express.app/Contents/MacOS/DEVONsphere Express.x86_64
  3297. 3284      file added: /Applications/DiskMaker X.app/Contents/MacOS/applet.x86_64
  3298. 3285      file modified: /Applications/DiskMaker X.app/Contents/Resources/Scripts/main.scpt
  3299. 3286      file added: /Applications/EndNote X7/Services/ENService.app/Contents/MacOS/ENService.x86_64
  3300. 3287      file added: /Applications/EndNote X7/Spell/Dictionary Converter.app/Contents/MacOS/Dictionary Converter.x86_64
  3301. 3288      file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/da.lproj/preview.css
  3302. 3289      file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/French.lproj/preview.css
  3303. 3290      file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/pt.lproj/preview.css
  3304. 3291      file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/pl.lproj/preview.css
  3305. 3292      file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/es_MX.lproj/preview.css
  3306. 3293      file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/fi.lproj/preview.css
  3307. 3294      file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/cs.lproj/preview.css
  3308. 3295      file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/sv.lproj/preview.css
  3309. 3296      file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/ko.lproj/preview.css
  3310. 3297      file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/zh_TW.lproj/preview.css
  3311. 3298      ...
  3312. 3299      file missing: /Applications/HardwareGrowler.app/Contents/Resources/pt.lproj
  3313. 3300      file added: /Applications/HyperPdf.1.1.3.app/Contents/MacOS/HyperPdf.x86_64
  3314. 3301      file missing: /Applications/HyperPdf.1.1.3.app/Contents/Library/QuickLook/Skim.qlgenerator/Contents/Resources/zh_TW.lproj/InfoPlist.strings
  3315. 3302      file modified: /Applications/iBooks.app/Contents/Resources/el.lproj/BKAppAboutPanel.strings
  3316. 3303      file modified: /Applications/iBooks.app/Contents/Resources/el.lproj/Localizable.strings
  3317. 3304      file modified: /Applications/iBooks.app/Contents/Resources/es_MX.lproj/MainMenu.strings
  3318. 3305      file modified: /Applications/iBooks.app/Contents/Resources/fr.lproj/BKAdvancedPreferences.strings
  3319. 3306      file modified: /Applications/iBooks.app/Contents/Resources/fr.lproj/BKGeneralPreferences.strings
  3320. 3307      file modified: /Applications/iBooks.app/Contents/Resources/fr.lproj/BKParentalPreferences.strings
  3321. 3308      file modified: /Applications/iBooks.app/Contents/Resources/fr.lproj/Localizable.strings
  3322. 3309      file modified: /Applications/iBooks.app/Contents/Resources/id.lproj/BKGeneralPreferences.strings
  3323. 3310      file modified: /Applications/iBooks.app/Contents/Resources/id.lproj/BKStorePreferences.strings
  3324. 3311      file modified: /Applications/iBooks.app/Contents/Resources/id.lproj/MainMenu.strings
  3325. 3312      ...
  3326. 3313      file added: /Applications/Insights.app/Contents/Resources/oc_source.png
  3327. 3314      file added: /Applications/Insights.app/Contents/Resources/statistical_review_of_world_energy_2011.xltx
  3328. 3315      file missing: /Applications/Intego/Washing Machine.app/Contents/Resources/UTIList.plist
  3329. 3316      file added: /Applications/iTerm.app/Contents/MacOS/iTerm.x86_64
  3330. 3317      file added: /Applications/KeyboardCleanTool.app/Contents/MacOS/KeyboardCleanTool.x86_64
  3331. 3318      file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote – Copy Link of Selected Note.lbaction/Contents/_CodeSignature/CodeDirectory
  3332. 3319      file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote – Copy Link of Selected Note.lbaction/Contents/_CodeSignature/CodeRequirements
  3333. 3320      file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote – Copy Link of Selected Note.lbaction/Contents/_CodeSignature/CodeResources
  3334. 3321      file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote – Copy Link of Selected Note.lbaction/Contents/_CodeSignature/CodeSignature
  3335. 3322      file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote – Copy Link of Selected Note.lbaction/Contents/Info.plist
  3336. 3323      file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote – Copy Link of Selected Note.lbaction/Contents/Resources/de.lproj/InfoPlist.strings
  3337. 3324      file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote – Copy Link of Selected Note.lbaction/Contents/Resources/en.lproj/InfoPlist.strings
  3338. 3325      file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote – Copy Link of Selected Note.lbaction/Contents/Scripts/default.scpt
  3339. 3326      file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote – New Note With File.lbaction/Contents/_CodeSignature/CodeDirectory
  3340. 3327      file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote – New Note With File.lbaction/Contents/_CodeSignature/CodeRequirements
  3341. 3328      ...
  3342. 3329      file added: /Applications/MacJournal.app/Contents/MacOS/MacJournal.x86_64
  3343. 3330      file modified: /Applications/Mail Plugin Manager.app/Contents/Resources/appcasts.plist
  3344. 3331      file added: /Applications/MarsEdit.app/Contents/MacOS/MarsEdit.x86_64
  3345. 3332      file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/ConsoleView.nib 1/classes.nib
  3346. 3333      file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/ConsoleView.nib 1/info.nib
  3347. 3334      file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/ConsoleView.nib 1/keyedobjects.nib
  3348. 3335      file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/IconView.nib 1/classes.nib
  3349. 3336      file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/IconView.nib 1/info.nib
  3350. 3337      file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/IconView.nib 1/keyedobjects.nib
  3351. 3338      file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/MainMenu.nib 1/classes.nib
  3352. 3339      file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/MainMenu.nib 1/info.nib
  3353. 3340      file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/MainMenu.nib 1/keyedobjects.nib
  3354. 3341      file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/Thumbnail.nib 1/classes.nib
  3355. 3342      ...
  3356. 3343      file added: /Applications/Paperless.app/Contents/MacOS/Paperless.x86_64
  3357. 3344      file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/Code/__init__.py
  3358. 3345      file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/DefaultPrefs.json
  3359. 3346      file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/Info.plist
  3360. 3347      file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/Resources/attribution.png
  3361. 3348      file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/Resources/icon-default.png
  3362. 3349      file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/VERSION
  3363. 3350      file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/README.md
  3364. 3351      file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Framework.bundle/.gitignore
  3365. 3352      file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Framework.bundle/Contents/Info.plist
  3366. 3353      file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Framework.bundle/Contents/Resources/icon-default.png
  3367. 3354      ...
  3368. 3355      file added: /Applications/RunePDF.app/Contents/MacOS/RunePDF.x86_64
  3369. 3356      file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/__pycache__/__init__.cpython-34.pyc
  3370. 3357      file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/__pycache__/dammit.cpython-34.pyc
  3371. 3358      file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/__pycache__/element.cpython-34.pyc
  3372. 3359      file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/builder/__pycache__/__init__.cpython-34.pyc
  3373. 3360      file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/builder/__pycache__/_html5lib.cpython-34.pyc
  3374. 3361      file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/builder/__pycache__/_htmlparser.cpython-34.pyc
  3375. 3362      file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/builder/__pycache__/_lxml.cpython-34.pyc
  3376. 3363      file added: /Applications/Sigil.app/Contents/python3lib/__pycache__/opf_newparser.cpython-34.pyc
  3377. 3364      file added: /Applications/Sigil.app/Contents/python3lib/__pycache__/xmlprocessor.cpython-34.pyc
  3378. 3365      file added: /Applications/Splashtop Personal.app/Contents/MacOS/Splashtop Personal.x86_64
  3379. 3366      file added: /Applications/StoryMill.app/Contents/MacOS/StoryMill.x86_64
  3380. 3367      file added: /Applications/Themes for iBooks Author.app/Contents/MacOS/Themes for iBooks Author.x86_64
  3381. 3368      file missing: /Applications/TinderboxSix.app/Contents/Resources/Tinderbox Six Help/help/elements/ContainerTitle.jpg
  3382. 3369      file missing: /Applications/TinderboxSix.app/Contents/Resources/color schemes/Shades of Red/Shades of Red.tbc
  3383. 3370      file missing: /Applications/TinderboxSix.app/Contents/Resources/Tinderbox Six Help/help/basic_concepts/prototypes.html
  3384. 3371      file missing: /Applications/TinderboxSix.app/Contents/Resources/Tinderbox5Help/elements/Timelineviews.html
  3385. 3372      file missing: /Applications/TinderboxSix.app/Contents/Resources/config/RSSChannel
  3386. 3373      file missing: /Applications/TinderboxSix.app/Contents/Resources/Tinderbox Six Help/help/elements/ParkingSpace.jpg
  3387. 3374      file missing: /Applications/TinderboxSix.app/Contents/Resources/badges/Symbols/moon.png
  3388. 3375      file missing: /Applications/TinderboxSix.app/Contents/Resources/Tinderbox Six Help/help/release_notes/6_1_0.html
  3389. 3376      file missing: /Applications/TinderboxSix.app/Contents/Resources/TbxURLInfoController.nib
  3390. 3377      file missing: /Applications/TinderboxSix.app/Contents/Resources/badges/Symbols/laptop.png
  3391. 3378      ...
  3392. 3379      file added: /Applications/VLC.app/Contents/MacOS/plugins/plugins.dat
  3393. 3380      file added: /Applications/VLC.app/Contents/MacOS/share/lua/extensions/140694-tvdb.lua
  3394. 3381      file added: /Applications/VLC.app/Contents/MacOS/share/lua/extensions/140695-imdb.lua
  3395. 3382      file added: /Applications/VLC.app/Contents/MacOS/share/lua/extensions/140697-tmdb.lua
  3396. 3383      file added: /Applications/WeNotify.app/Contents/Resources/finishArchive.sh
  3397. 3384  
  3398. 3385  Bad kernel extensions
  3399. 3386  
  3400. 3387      /System/Library/Extensions/AppleOSXUSBNCM.kext
  3401. 3388  
  3402. 3389  Installations
  3403. 3390  
  3404. 3391      Day One: 11/13/15, 4:27 AM
  3405. 3392      Electric Sheep 2.7b36: 11/13/15, 3:05 AM
  3406. 3393      Monity: 11/12/15, 10:07 PM
  3407. 3394      VirusBarrierDefinitions: 11/12/15, 10:05 AM
  3408. 3395      ActiveState ActiveTcl 8.6.4.1.299124: 11/11/15, 7:42 AM
  3409. 3396  
  3410. 3397  Elapsed time (sec): 42302
RAW Paste Data
We use cookies for various purposes including analytics. By continuing to use Pastebin, you agree to our use of cookies as described in the Cookies Policy. OK, I Understand
 
Top