Public Pastes
Pastebin PRO Accounts AUTUMN SPECIAL! For a limited time only get 40% discount on a LIFETIME PRO account! Offer Ends Soon!
SHARE
TWEET

Diagnostic 11Nov2015

Dani258 Nov 11th, 2015 118 Never
  1.    1  Start time: 14:45:51 11/11/15
  2.    2  
  3.    3  Revision: 1368
  4.    4  
  5.    5  Model Identifier: MacBookPro11,1
  6.    6  System Version: OS X 10.11.1 (15B42)
  7.    7  Kernel Version: Darwin 15.0.0
  8.    8  Time since boot: 2:07
  9.    9  
  10.   10  Bluetooth
  11.   11  
  12.   12      Apple Magic Mouse
  13.   13  
  14.   14  System load
  15.   15  
  16.   16      combined level = Bad
  17.   17      - battery level = Bad
  18.   18  
  19.   19  Energy (lifetime)
  20.   20  
  21.   21      WindowServer (UID 88): 14.91
  22.   22      kernel_task (UID 0): 7.03
  23.   23  
  24.   24  Global prefs (system)
  25.   25  
  26.   26      MultipleSessionEnabled = 1
  27.   27  
  28.   28  Firewall: On
  29.   29  
  30.   30  Listeners
  31.   31  
  32.   32      cupsd: ipp
  33.   33      kdc: kerberos
  34.   34      launchd: afpovertcp
  35.   35      launchd: microsoft-ds
  36.   36  
  37.   37  Diagnostic reports
  38.   38  
  39.   39      2015-11-03 Mail crash
  40.   40      2015-11-03 com.apple.CommerceKit.TransactionService crash
  41.   41      2015-11-03 com.apple.WebKit.WebContent crash
  42.   42      2015-11-03 com.apple.preference.network.remoteservice crash
  43.   43      2015-11-04 helpd crash
  44.   44      2015-11-05 Canon IJ Scan Utility2 crash x2
  45.   45      2015-11-08 Keychain Access hang
  46.   46      2015-11-08 System Preferences hang x2
  47.   47      2015-11-08 securityd crash
  48.   48      2015-11-09 iTunes hang
  49.   49      2015-11-10 Finder crash
  50.   50      2015-11-10 familycircled crash
  51.   51      2015-11-11 Canon IJ Scan Utility2 crash
  52.   52      2015-11-11 Keychain Access hang
  53.   53      2015-11-11 System Preferences hang
  54.   54      2015-11-11 com.apple.WebKit.Networking crash
  55.   55      2015-11-11 securityd crash
  56.   56  
  57.   57  HID errors: 18
  58.   58  
  59.   59  Kernel log
  60.   60  
  61.   61      Nov 11 10:41:31 AppleUSBMultitouchDriver::checkStatus - received Status Packet, Payload 2: device was reinitialized
  62.   62      Nov 11 10:41:31 com_seagate_IOPowSec00_10_5: GetVendorAndModelIDInfo failed
  63.   63      Nov 11 10:41:31 com_maxtor_IOPowSec00_10_5: GetVendorAndModelIDInfo failed
  64.   64      Nov 11 10:41:39 utun_start: ifnet_disable_output returned error 12
  65.   65      Nov 11 11:34:26 utun_start: ctl_getenqueuepacketcount returned error 22
  66.   66      Nov 11 11:34:26 utun_start: ctl_getenqueuepacketcount returned error 22
  67.   67      Nov 11 11:58:36 Process launchd [1] disabling system-wide I/O Throttling
  68.   68      Nov 11 11:58:36 Process launchd [1] disabling system-wide CPU Throttling
  69.   69      Nov 11 11:59:48 Can't load kext com.apple.driver.AppleCameraInCouldn't alloc class "AppleThunderboltIPService"
  70.   70      Nov 11 11:59:56 utun_start: ifnet_disable_output returned error 12
  71.   71      Nov 11 12:32:02 AppleKeyStore: operation failed (pid: 319 sel: 26 ret: e00002e2 '-536870174')
  72.   72      Nov 11 12:32:02 AppleKeyStore: operation failed (pid: 319 sel: 26 ret: e00002e2 '-536870174')
  73.   73      Nov 11 12:38:04 Process launchd [1] disabling system-wide I/O Throttling
  74.   74      Nov 11 12:38:04 Process launchd [1] disabling system-wide CPU Throttling
  75.   75      Nov 11 12:38:49 TBIOBlockStorageDriver: super::probe failed
  76.   76      Nov 11 12:38:49 IO80211ControllerMonitor::configureSubscriptions() failed to add subscriptionIO80211Controller::start _controller is 0xcb556f51030a4ff9, provider is 0xcb556f5043aad4f9
  77.   77      Nov 11 12:38:49 init: error getting PHY_MODE;  using MODE_UNKNOWN
  78.   78      Nov 11 12:38:49 AppleUSBMultitouchDriver::checkStatus - received Status Packet, Payload 2: device was reinitialized
  79.   79      Nov 11 12:38:49 com_seagate_IOPowSec00_10_5: GetVendorAndModelIDInfo failed
  80.   80      Nov 11 12:38:49 com_maxtor_IOPowSec00_10_5: GetVendorAndModelIDInfo failed
  81.   81      Nov 11 12:38:58 utun_start: ifnet_disable_output returned error 12
  82.   82      Nov 11 12:54:47 AppleKeyStore: operation failed (pid: 274 sel: 26 ret: e00002e2 '-536870174')
  83.   83      Nov 11 12:54:47 AppleKeyStore: operation failed (pid: 274 sel: 26 ret: e00002e2 '-536870174')
  84.   84      Nov 11 13:28:19 AppleUSBMultitouchDriver::checkStatus - received Status Packet, Payload 2: device was reinitialized
  85.   85      Nov 11 14:41:55 AppleKeyStore: operation failed (pid: 3861 sel: 13 ret: e00002e2 '-536870174')
  86.   86  
  87.   87  System log
  88.   88  
  89.   89      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextConcatCTM: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  90.   90      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextSaveGState: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  91.   91      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextDrawImages: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  92.   92      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextRestoreGState: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  93.   93      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextRestoreGState: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  94.   94      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextGetCTM: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  95.   95      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextGetCTM: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  96.   96      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextGetDefaultUserSpaceToDeviceSpaceTransform: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  97.   97      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextSaveGState: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  98.   98      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextConcatCTM: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  99.   99      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextSaveGState: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  100.  100      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextClipToRect: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  101.  101      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextGetClipBoundingBox: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  102.  102      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextRestoreGState: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  103.  103      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextRestoreGState: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  104.  104      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextScaleCTM: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  105.  105      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextScaleCTM: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  106.  106      Nov 11 14:33:19 com.apple.prefs.backup.remoteservice: CGContextGetCTM: invalid context 0x0. If you want to see the backtrace, please set CG_CONTEXT_SHOW_BACKTRACE environmental variable.
  107.  107      Nov 11 14:37:25 accountsd: invalid nil value for 'sharedInstance'
  108.  108      Nov 11 14:42:40 diagnosticd: error evaluating process info - pid: 82, puniqueid: 82
  109.  109      Nov 11 14:43:09 loginwindow: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/Keychain%20Access_UUID.plist.
  110.  110      Nov 11 14:43:37 AppleSpell: Lexicon creation failed: Lexicon resources not found
  111.  111      Nov 11 14:46:25 apsd: can't create keychain, status = -67671
  112.  112      Nov 11 14:46:25 apsd: can't create keychain, status = -67671
  113.  113      Nov 11 14:46:25 apsd: can't create keychain, status = -67671
  114.  114  
  115.  115  launchd log
  116.  116  
  117.  117      Nov 11 10:11:47 com.apple.airplaydiagnostics.server: Unrecognized MachService property: ResetAtClose
  118.  118      Nov 11 10:41:30 : Failed to remove file or directory: name = dyld_shared_cache_x86_64h, error = 1: Operation not permitted. Further logging suppressed.
  119.  119      Nov 11 10:41:31 com.apple.airplaydiagnostics.server: Unrecognized MachService property: ResetAtClose
  120.  120      Nov 11 10:42:01 com.apple.xpc.launchd.user.domain.248.100014.Aqua: Could not import service from caller: caller = otherbsd.343, service = com.apple.photostream-agent, error = 119: Service is disabled
  121.  121      Nov 11 10:42:01 com.apple.xpc.launchd.user.domain.248.100014.Aqua: Could not import service from caller: caller = otherbsd.343, service = com.rockysandstudio.Memory-Diag.Launch-Helper, error = 119: Service is disabled
  122.  122      Nov 11 10:42:01 com.apple.xpc.launchd.user.domain.248.100014.Aqua: Could not import service from caller: caller = otherbsd.343, service = jp.co.canon.ij.scanutility2.CIJSUAgent, error = 119: Service is disabled
  123.  123      Nov 11 10:42:09 com.apple.xpc.launchd.user.domain.502.100007.Aqua: Could not import service from caller: caller = otherbsd.254, service = jp.co.canon.ij.scanutility2.CIJSUAgent, error = 119: Service is disabled
  124.  124      Nov 11 10:42:09 com.apple.xpc.launchd.user.domain.502.100007.Aqua: Could not import service from caller: caller = otherbsd.254, service = com.apple.photostream-agent, error = 119: Service is disabled
  125.  125      Nov 11 10:42:09 com.apple.xpc.launchd.user.domain.502.100007.Aqua: Could not import service from caller: caller = otherbsd.254, service = com.rockysandstudio.Memory-Diag.Launch-Helper, error = 119: Service is disabled
  126.  126      Nov 11 11:01:03 com.apple.xpc.launchd.user.domain.501.100030.Aqua: Could not import service from caller: caller = otherbsd.712, service = com.apple.photostream-agent, error = 119: Service is disabled
  127.  127      Nov 11 11:01:03 com.apple.xpc.launchd.user.domain.501.100030.Aqua: Could not import service from caller: caller = otherbsd.712, service = com.rockysandstudio.Memory-Diag.Launch-Helper, error = 119: Service is disabled
  128.  128      Nov 11 11:01:03 com.apple.xpc.launchd.user.domain.501.100030.Aqua: Could not import service from caller: caller = otherbsd.712, service = jp.co.canon.ij.scanutility2.CIJSUAgent, error = 119: Service is disabled
  129.  129      Nov 11 11:34:33 com.apple.xpc.launchd.user.domain.502.100057.Aqua: Could not import service from caller: caller = otherbsd.1114, service = jp.co.canon.ij.scanutility2.CIJSUAgent, error = 119: Service is disabled
  130.  130      Nov 11 11:34:33 com.apple.xpc.launchd.user.domain.502.100057.Aqua: Could not import service from caller: caller = otherbsd.1114, service = com.apple.photostream-agent, error = 119: Service is disabled
  131.  131      Nov 11 11:34:33 com.apple.xpc.launchd.user.domain.502.100057.Aqua: Could not import service from caller: caller = otherbsd.1114, service = com.rockysandstudio.Memory-Diag.Launch-Helper, error = 119: Service is disabled
  132.  132      Nov 11 11:39:01 com.apple.xpc.launchd.user.domain.501.100065.Aqua: Could not import service from caller: caller = otherbsd.1266, service = com.apple.photostream-agent, error = 119: Service is disabled
  133.  133      Nov 11 11:39:01 com.apple.xpc.launchd.user.domain.501.100065.Aqua: Could not import service from caller: caller = otherbsd.1266, service = com.rockysandstudio.Memory-Diag.Launch-Helper, error = 119: Service is disabled
  134.  134      Nov 11 11:39:01 com.apple.xpc.launchd.user.domain.501.100065.Aqua: Could not import service from caller: caller = otherbsd.1266, service = jp.co.canon.ij.scanutility2.CIJSUAgent, error = 119: Service is disabled
  135.  135      Nov 11 11:59:46 : Failed to remove file or directory: name = dyld_shared_cache_x86_64h, error = 1: Operation not permitted. Further logging suppressed.
  136.  136      Nov 11 11:59:46 com.apple.airplaydiagnostics.server: Unrecognized MachService property: ResetAtClose
  137.  137      Nov 11 12:38:48 : Failed to remove file or directory: name = dyld_shared_cache_x86_64h, error = 1: Operation not permitted. Further logging suppressed.
  138.  138      Nov 11 12:38:49 com.apple.airplaydiagnostics.server: Unrecognized MachService property: ResetAtClose
  139.  139      Nov 11 12:39:08 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.253, service = com.apple.photostream-agent, error = 119: Service is disabled
  140.  140      Nov 11 12:39:08 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.253, service = com.rockysandstudio.Memory-Diag.Launch-Helper, error = 119: Service is disabled
  141.  141      Nov 11 12:39:08 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.253, service = jp.co.canon.ij.scanutility2.CIJSUAgent, error = 119: Service is disabled
  142.  142  
  143.  143  Console log
  144.  144  
  145.  145      Nov  4 20:35:19 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/Canon%20IJ%20Scan%20Utility2_UUID.plist.
  146.  146      Nov  4 20:39:15 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/Canon%20IJ%20Scan%20Utility2_UUID.plist.
  147.  147      Nov  5 18:35:31 fontd: Failed to open read-only database, regenerating DB
  148.  148      Nov  8 12:38:13 fontd: XType - wal checkpoint: 0, -1, -1.
  149.  149      Nov  8 13:08:10 fontd: Failed to open read-only database, regenerating DB
  150.  150      Nov  9 19:08:19 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/familycircled_UUID.plist.
  151.  151      Nov 10 08:50:59 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/Finder_UUID.plist.
  152.  152      Nov 10 13:41:09 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/Canon%20IJ%20Scan%20Utility2_UUID.plist.
  153.  153      Nov 11 10:12:59 fontd: XType - wal checkpoint: 0, -1, -1.
  154.  154      Nov 11 11:01:04 fontd: Failed to open read-only database, regenerating DB
  155.  155      Nov 11 12:00:19 fontd: XType - wal checkpoint: 0, -1, -1.
  156.  156      Nov 11 12:39:08 fontd: Failed to open read-only database, regenerating DB
  157.  157  
  158.  158  System services loaded
  159.  159  
  160.  160      com.adobe.fpsaud
  161.  161      com.apple.logd
  162.  162      -     status: 1
  163.  163      com.apple.securityd
  164.  164      -     status: -11
  165.  165      com.apple.watchdogd
  166.  166      com.microsoft.office.licensing.helper
  167.  167      com.seagate.TBDecorator.plist
  168.  168      jp.co.canon.MasterInstaller
  169.  169  
  170.  170  System services disabled
  171.  171  
  172.  172      com.openssh.sshd
  173.  173  
  174.  174  Login services loaded
  175.  175  
  176.  176      com.apple.helpd
  177.  177      -     status: -15
  178.  178      com.microsoft.SyncServicesAgent
  179.  179  
  180.  180  Contents of /Library/LaunchDaemons/com.seagate.TBDecorator.plist
  181.  181      -     mod date: Oct 11 17:46:28 2013
  182.  182      -     size (B): 617
  183.  183      -     checksum: 3070240373
  184.  184  
  185.  185      <?xml version="1.0" encoding="UTF-8"?>
  186.  186      <!DOCTYPE plist PUBLIC "-//Apple Computer//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  187.  187      <!--
  188.  188         com.seagate.TBDecorator.plist
  189.  189         SeagateDiagnostics
  190.  190         Created by John Brisbin on 3/10/10.
  191.  191         Copyright 2010 Seagate Technologies LLC.. All rights reserved.
  192.  192      -->
  193.  193      <plist version="1.0">
  194.  194      <dict>
  195.  195            <key>KeepAlive</key>
  196.  196            <true/>
  197.  197            <key>Label</key>
  198.  198            <string>com.seagate.TBDecorator.plist</string>
  199.  199            <key>RunAtLoad</key>
  200.  200            <true/>
  201.  201            <key>ProgramArguments</key>
  202.  202            <array>
  203.  203                    <string>/Library/Application Support/Seagate/TBLoopDriveParams</string>
  204.  204            </array>
  205.  205      </dict>
  206.  206      </plist>
  207.  207  
  208.  208  Contents of /Library/LaunchDaemons/jp.co.canon.MasterInstaller.plist
  209.  209      -     mod date: Jun  2 22:45:42 2014
  210.  210      -     size (B): 736
  211.  211      -     checksum: 1894334785
  212.  212  
  213.  213      <?xml version="1.0" encoding="UTF-8"?>
  214.  214      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  215.  215      <plist version="1.0">
  216.  216      <dict>
  217.  217            <key>Label</key>
  218.  218            <string>jp.co.canon.MasterInstaller</string>
  219.  219            <key>ProgramArguments</key>
  220.  220            <array>
  221.  221                    <string>/Library/PrivilegedHelperTools/jp.co.canon.MasterInstaller</string>
  222.  222            </array>
  223.  223            <key>ServiceIPC</key>
  224.  224            <true/>
  225.  225            <key>Sockets</key>
  226.  226            <dict>
  227.  227                    <key>MasterSocket</key>
  228.  228                    <dict>
  229.  229                            <key>SockFamily</key>
  230.  230                            <string>Unix</string>
  231.  231                            <key>SockPathMode</key>
  232.  232                            <integer>438</integer>
  233.  233                            <key>SockPathName</key>
  234.  234                            <string>/var/run/jp.co.canon.MasterInstaller.socket</string>
  235.  235                            <key>SockType</key>
  236.  236                            <string>Stream</string>
  237.  237                    </dict>
  238.  238  
  239.  239      ...and 3 more line(s)
  240.  240  
  241.  241  Contents of Library/LaunchAgents/com.microsoft.LaunchAgent.SyncServicesAgent.plist
  242.  242      -     mod date: Nov 11 14:05:05 2015
  243.  243      -     size (B): 484
  244.  244      -     checksum: 3051698494
  245.  245  
  246.  246      <?xml version="1.0" encoding="UTF-8"?>
  247.  247      <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
  248.  248      <plist version="1.0">
  249.  249      <dict>
  250.  250            <key>KeepAlive</key>
  251.  251            <false/>
  252.  252            <key>Label</key>
  253.  253            <string>com.microsoft.SyncServicesAgent</string>
  254.  254            <key>OnDemand</key>
  255.  255            <false/>
  256.  256            <key>ProgramArguments</key>
  257.  257            <array>
  258.  258                    <string>/Applications/Microsoft Office 2011/Office/SyncServicesAgent.app/Contents/MacOS/SyncServicesAgent</string>
  259.  259            </array>
  260.  260      </dict>
  261.  261      </plist>
  262.  262  
  263.  263  User login items
  264.  264  
  265.  265      iTunesHelper
  266.  266      -     /Applications/iTunes.app/Contents/MacOS/iTunesHelper.app
  267.  267      Dropbox
  268.  268      -     /Applications/Dropbox.app
  269.  269  
  270.  270  Safari extensions
  271.  271  
  272.  272      Grammarly Spell Checker & Grammar Checker
  273.  273      -     com.safari.grammarlyspellcheckergrammarcheckerUUID
  274.  274  
  275.  275  iCloud errors
  276.  276  
  277.  277      cloudd        964
  278.  278      Finder        359
  279.  279      backupd       140
  280.  280      comapple.CloudPhotosConfiguration     101
  281.  281      bird  44
  282.  282      comapple.InputMethodKit.TextReplacementService        39
  283.  283      cloudphotosd  25
  284.  284      Photos        12
  285.  285      comapple.preferences.internetaccounts.remoteservice   4
  286.  286      mdworker      3
  287.  287      comapple.ncplugin.weather     1
  288.  288  
  289.  289  Continuity errors
  290.  290  
  291.  291      sharingd      106
  292.  292      TextEdit      6
  293.  293      sharedfilelistd       4
  294.  294      comapple.appkit.xpc.openAndSavePanelService   4
  295.  295  
  296.  296  Lockfiles: 1
  297.  297  
  298.  298  Global prefs (user)
  299.  299  
  300.  300      AppleEnableMenuBarTransparency = 1
  301.  301  
  302.  302  Accessibility
  303.  303  
  304.  304      Keyboard Zoom: On
  305.  305  
  306.  306  Extensions
  307.  307  
  308.  308      /Library/Extensions/BJUSBLoad.kext
  309.  309      -     jp.co.canon.bj.print.BJUSBLoad
  310.  310      /Library/Extensions/CIJUSBLoad.kext
  311.  311      -     jp.co.canon.ij.print.CIJUSBLoad
  312.  312      /Library/Extensions/Seagate Storage Driver.kext/Contents/PlugIns/SeagateDriveIcons.kext
  313.  313      -     com.seagate.driver.SeagateDriveIcons
  314.  314      /Library/Extensions/Seagate Storage Driver.kext/Contents/PlugIns/SeagateLeafPowSecDriver_10_4.kext
  315.  315      -     com.seagate.driver.PowSecLeafDriver_10_4
  316.  316      /Library/Extensions/Seagate Storage Driver.kext/Contents/PlugIns/SeagateLeafPowSecDriver_10_5.kext
  317.  317      -     com.seagate.driver.PowSecLeafDriver_10_5
  318.  318      /Library/Extensions/Seagate Storage Driver.kext
  319.  319      -     com.seagate.driver.PowSecDriverCore
  320.  320      /System/Library/Extensions/BJUSBLoad.kext
  321.  321      -     jp.co.canon.bj.print.BJUSBLoad
  322.  322      /System/Library/Extensions/JMicronATA.kext
  323.  323      -     com.jmicron.JMicronATA
  324.  324      /System/Library/Extensions/LaCie_RemoteComms.kext
  325.  325      -     com.lacie.driver.LaCie_RemoteComms
  326.  326  
  327.  327  Applications
  328.  328  
  329.  329      /Applications/Microsoft Messenger.app
  330.  330      -     com.microsoft.Messenger
  331.  331      /Applications/Microsoft Office 2011/Office/Add-Ins/Solver.app
  332.  332      -     com.microsoft.ASApplication
  333.  333      /Applications/Microsoft Office 2011/Office/Equation Editor.app
  334.  334      -     com.microsoft.EquationEditor
  335.  335      /Applications/Microsoft Office 2011/Office/Microsoft Office Setup Assistant.app
  336.  336      -     com.microsoft.office.setupassistant
  337.  337      /Applications/Microsoft Office 2011/Office/Microsoft Query.app
  338.  338      -     com.microsoft.Query
  339.  339      /Applications/Remote Desktop Connection.app
  340.  340      -     com.microsoft.rdc
  341.  341      /Library/Application Support/Microsoft/MAU2.0/Microsoft AutoUpdate.app
  342.  342      -     com.microsoft.autoupdate2
  343.  343      /Library/Application Support/Microsoft/MERP2.0/Microsoft Error Reporting.app
  344.  344      -     com.microsoft.error_reporting
  345.  345      /Library/Application Support/Microsoft/MERP2.0/Microsoft Ship Asserts.app
  346.  346      -     com.microsoft.netlib.shipassertprocess
  347.  347      /Users/USER/Library/Printers/Canon MG7100 series 2.app
  348.  348      -     com.apple.print.PrinterProxy
  349.  349  
  350.  350  PrefPane
  351.  351  
  352.  352      /Library/PreferencePanes/DashboardPreferences.prefPane
  353.  353      -     com.seagate.dashboard.preferences
  354.  354      /Library/PreferencePanes/Flash Player.prefPane
  355.  355      -     com.adobe.flashplayerpreferences
  356.  356      /Library/PreferencePanes/OSXFUSE.prefPane
  357.  357      -     com.github.osxfuse.OSXFUSEPrefPane
  358.  358  
  359.  359  Bundles
  360.  360  
  361.  361      /Library/Internet Plug-Ins/EPPEX Plugin.plugin
  362.  362      -     jp.co.canon.MIG Plugin
  363.  363      /Library/Internet Plug-Ins/Flash Player.plugin
  364.  364      -     com.macromedia.Flash Player.plugin
  365.  365      /Library/Internet Plug-Ins/SharePointBrowserPlugin.plugin
  366.  366      -     com.microsoft.sharepoint.browserplugin
  367.  367      /Users/USER/Library/Application Support/Google/Chrome/Default/Extensions/alelhddbbhepgpmgidjdcjakblofbmce/3.5.10_0/plugins/screen_captures.plugin
  368.  368      -     chrome.screen_capture
  369.  369      /Users/USER/Library/Application Support/Google/Chrome/Default/Extensions/alelhddbbhepgpmgidjdcjakblofbmce/3.6.5_0/plugins/screen_captures.plugin
  370.  370      -     chrome.screen_capture
  371.  371      /Users/USER/Library/Application Support/Google/Chrome/Default/Extensions/alelhddbbhepgpmgidjdcjakblofbmce/3.6.7_0/plugins/screen_captures.plugin
  372.  372      -     chrome.screen_capture
  373.  373      /Users/USER/Library/Application Support/Google/Chrome/Default/Extensions/alelhddbbhepgpmgidjdcjakblofbmce/3.6_0/plugins/screen_captures.plugin
  374.  374      -     chrome.screen_capture
  375.  375  
  376.  376  Bundles (new)
  377.  377  
  378.  378      /Applications/Keynote.app
  379.  379      -     com.apple.iWork.Keynote
  380.  380      /Applications/Microsoft Office 2011/Office/Add-Ins/Solver.app
  381.  381      -     com.microsoft.ASApplication
  382.  382      /Applications/Microsoft Office 2011/Office/Microsoft Query.app
  383.  383      -     com.microsoft.Query
  384.  384      /Applications/Numbers.app
  385.  385      -     com.apple.iWork.Numbers
  386.  386      /Applications/Pages.app
  387.  387      -     com.apple.iWork.Pages
  388.  388      /Applications/Utilities/Adobe Flash Player Install Manager.app
  389.  389      -     com.adobe.flashplayer.installmanager
  390.  390      /Library/Internet Plug-Ins/Flash Player.plugin
  391.  391      -     com.macromedia.Flash Player.plugin
  392.  392      /Library/PreferencePanes/Flash Player.prefPane
  393.  393      -     com.adobe.flashplayerpreferences
  394.  394      /System/Library/Intelligent Suggestions/Assets.suggestionsassets
  395.  395      -     com.apple.MobileAsset.CoreSuggestions
  396.  396      /Users/USER/Library/Printers/Canon MG7100 series 2.app
  397.  397      -     com.apple.print.PrinterProxy
  398.  398      /usr/share/mecabra/updates/com.apple.inputmethod.SCIM.bundle
  399.  399      -     com.apple.inputmethod.SCIM
  400.  400      /usr/share/mecabra/updates/com.apple.inputmethod.TCIM.bundle
  401.  401      -     com.apple.inputmethod.TCIM
  402.  402  
  403.  403  Library paths
  404.  404  
  405.  405      /Applications/Microsoft Office 2011/Office/MicrosoftSetupUI.framework/Libraries/mbupgx.dylib
  406.  406      /Applications/Microsoft Office 2011/Office/OPF.framework/Versions/14/Resources/OPF_Common.dylib
  407.  407      /Applications/Microsoft Office 2011/Office/Visual Basic for Applications.framework/Versions/14/Frameworks/Fm20.dylib
  408.  408      /Applications/Microsoft Office 2011/Office/Visual Basic for Applications.framework/Versions/14/Frameworks/MicrosoftOLE2TypesLib.dylib
  409.  409      /Applications/Microsoft Office 2011/Office/Visual Basic for Applications.framework/Versions/14/Frameworks/RefEdit.dylib
  410.  410      /Applications/Microsoft Office 2011/Office/Visual Basic for Applications.framework/Versions/14/Frameworks/RichEdit.dylib
  411.  411      /Users/USER/Library/Application Support/Google/Chrome/WidevineCDM/1.4.1.377/_platform_specific/mac_x86/libwidevinecdm.dylib
  412.  412  
  413.  413  App extensions
  414.  414  
  415.  415      com.crowdedroad.ifaxpromac.widget
  416.  416      com.getdropbox.dropbox.garcon
  417.  417      com.rockysandstudio.Memory-Diag.Widget
  418.  418  
  419.  419  Bad kernel extensions
  420.  420  
  421.  421      /System/Library/Extensions/AppleOSXUSBNCM.kext
  422.  422      /System/Library/Extensions/LaCie_RemoteComms.kext
  423.  423  
  424.  424  Installations
  425.  425  
  426.  426      Office 2011 14.5.8 Update: 11/11/15, 2:07 PM
  427.  427      Adobe Flash Player: 11/10/15, 9:12 PM
  428.  428      Adobe Flash Player: 11/8/15, 7:11 PM
  429.  429      Adobe Flash Player: 11/5/15, 10:31 AM
  430.  430      DaisyDisk: 11/2/15, 8:23 PM
  431.  431  
  432.  432  Elapsed time (sec): 422
RAW Paste Data
Top