- 1 Start time: 01:36:10 11/14/15
- 2
- 3 Revision: 1368
- 4
- 5 Model Identifier: iMac11,3
- 6 System Version: OS X 10.11.1 (15B42)
- 7 Kernel Version: Darwin 15.0.0
- 8 Time since boot: 11 minutes
- 9
- 10 SerialATA
- 11
- 12 WDC WD1001FALS-40Y6A0
- 13
- 14 USB
- 15
- 16 My Book 1230 (Western Digital Technologies, Inc.)
- 17 2.4G Keyboard Mouse (ProVision Technology, Inc.)
- 18
- 19 Energy (lifetime)
- 20
- 21 kernel_task (UID 0): 17.32
- 22 com.apple.WebKit.WebContent (UID 501): 7.38
- 23
- 24 Energy (sampled)
- 25
- 26 kernel_task (UID 0): 11.33
- 27 com.apple.WebKit.WebContent (UID 501): 9.56
- 28
- 29 Global prefs (system)
- 30
- 31 MultipleSessionEnabled = 1
- 32
- 33 Trust settings: admin 6, user 12
- 34
- 35 Firewall: On
- 36
- 37 DNS: 208.67.222.222 (static)
- 38
- 39 Listeners
- 40
- 41 kdc: kerberos
- 42 launchd: afpovertcp
- 43 launchd: ftp
- 44 launchd: microsoft-ds
- 45 launchd: ssh
- 46
- 47 Diagnostic reports
- 48
- 49 2015-10-25 Paragon Updater hang
- 50 2015-10-26 iTunes hang
- 51 2015-10-27 AppYM hang
- 52 2015-10-27 Little_Snitch_Agent_1679.spindump.txt txt
- 53 2015-10-27 MusicManagerHelper crash x2
- 54 2015-10-27 postflightinit crash x2
- 55 2015-10-31 iTunes hang
- 56 2015-11-03 MusicManagerHelper crash
- 57 2015-11-03 mds crash
- 58 2015-11-06 Snagit hang
- 59 2015-11-07 MusicManagerHelper crash
- 60 2015-11-08 Kernel panic
- 61 2015-11-08 Little_Snitch_Agent_3213.spindump.txt txt
- 62 2015-11-09 Kernel panic
- 63 2015-11-09 MusicManagerHelper crash
- 64 2015-11-09 Plex Media Server crash
- 65 2015-11-11 MusicManagerHelper crash
- 66 2015-11-11 suggestd crash x2
- 67 2015-11-13 Little_Snitch_Agent_10674.spindump.txt txt
- 68 2015-11-13 Little_Snitch_Agent_1629.spindump.txt txt
- 69 2015-11-13 Little_Snitch_Agent_2902.spindump.txt txt
- 70 2015-11-13 Little_Snitch_Agent_375.spindump.txt txt
- 71 2015-11-13 Little_Snitch_Agent_41568.spindump.txt txt
- 72 2015-11-13 Little_Snitch_Agent_579.spindump.txt txt
- 73 2015-11-13 Little_Snitch_Agent_6273.spindump.txt txt
- 74
- 75 HID errors: 3
- 76
- 77 Kernel log
- 78
- 79 Nov 13 01:08:15 firefox[832] triggered unnest of range 0x7fff8b400000->0x7fff8b600000 of DYLD shared region in VM map 0x853b03b1f9bce77f. While not abnormal for debuggers, this increases system memory footprint until the target exits.
- 80 Nov 13 01:40:59 Safari[2875] triggered unnest of range 0x7fff89c00000->0x7fff89e00000 of DYLD shared region in VM map 0x853b03b1faa47bdf. While not abnormal for debuggers, this increases system memory footprint until the target exits.
- 81 Nov 13 01:50:25 [IOBluetoothHostController][handleACLPacketTimeout] -- Disconnecting due to device not responding (ACL Packet timed out) for connection handle 0xe
- 82 Nov 13 06:32:02 Over-release of kernel-internal importance assertions for pid 483 (Little Snitch Ne), dropping 1 assertion(s) but task only has 0 remaining (0 external).
- 83 Nov 13 07:38:47 msdosfs_update_fsinfo: error 6 reading FSInfo
- 84 Nov 13 07:38:51 msdosfs_fat_uninit_vol: error 6 from msdosfs_fat_cache_flush
- 85 Nov 13 15:49:32 msdosfs_update_fsinfo: error 6 reading FSInfo
- 86 Nov 13 15:49:32 msdosfs_fat_uninit_vol: error 6 from msdosfs_fat_cache_flush
- 87 Nov 13 19:42:03 firefox[62276] triggered unnest of range 0x7fff8b400000->0x7fff8b600000 of DYLD shared region in VM map 0x853b03b1e9d46dcf. While not abnormal for debuggers, this increases system memory footprint until the target exits.
- 88 Nov 13 21:47:58 075247.575016 IOUSBHostHIDDevice@fd133400,1: IOUSBHostHIDDevice::interruptRetry: resetting device due to IO failures
- 89 Nov 13 22:47:10 decmpfs.c:1432:decmpfs_read_compressed: /System/Library/Frameworks/CoreGraphics.framework/Versions/A/Resources/libCMaps.A.dylib: cluster_copy_upl_data err 14
- 90 Nov 13 22:47:10 decmpfs.c:1456:decmpfs_read_compressed: /System/Library/Frameworks/CoreGraphics.framework/Versions/A/Resources/libCMaps.A.dylib: err 14
- 91 Nov 14 00:12:38 decmpfs.c:1432:decmpfs_read_compressed: /System/Library/Frameworks/Quartz.framework/Versions/A/Frameworks/QuickLookUI.framework/Versions/A/PlugIns/Web.qldisplay/Contents/MacOS/Web: cluster_copy_upl_data err 14
- 92 Nov 14 00:12:38 decmpfs.c:1456:decmpfs_read_compressed: /System/Library/Frameworks/Quartz.framework/Versions/A/Frameworks/QuickLookUI.framework/Versions/A/PlugIns/Web.qldisplay/Contents/MacOS/Web: err 14
- 93 Nov 14 00:19:48 firefox[87260] triggered unnest of range 0x7fff8b400000->0x7fff8b600000 of DYLD shared region in VM map 0x853b03b1f8522d4f. While not abnormal for debuggers, this increases system memory footprint until the target exits.
- 94 Nov 14 01:04:37 firefox[93578] triggered unnest of range 0x7fff8b400000->0x7fff8b600000 of DYLD shared region in VM map 0x853b03b1fc0af8f7. While not abnormal for debuggers, this increases system memory footprint until the target exits.
- 95 Nov 14 01:22:19 Process launchd [1] disabling system-wide I/O Throttling
- 96 Nov 14 01:22:19 Process launchd [1] disabling system-wide CPU Throttling
- 97 Nov 14 01:27:04 IO80211ControllerMonitor::configureSubscriptions() failed to add subscriptionIO80211Controller::start _controller is 0x71202fb2b765ad8f, provider is 0x71202fb1f8353c8f
- 98 Nov 14 01:27:04 000001.426291 StandardUSB::validateEndpointMaxPacketSize: USB 2.0 5.[5-8].3: endpoint 0x00 invalid wMaxPacketSize 0x0008
- 99 Nov 14 01:27:04 init: error getting PHY_MODE; using MODE_UNKNOWN
- 100 Nov 14 01:27:15 ** GPU Hardware VM is disabled (multispace: disabled, page table updates with DMA: disabled, non-contiguous VRAM: disabled)
- 101 Nov 14 01:27:52 utun_start: ifnet_disable_output returned error 12
- 102 Nov 14 01:28:32 firefox[357] triggered unnest of range 0x7fff93e00000->0x7fff94000000 of DYLD shared region in VM map 0xb77a29fb5ee05e6f. While not abnormal for debuggers, this increases system memory footprint until the target exits.
- 103 Nov 14 01:31:26 000338.542627 IOUSBHostHIDDevice@fd133400,1: IOUSBHostHIDDevice::interruptRetry: resetting device due to IO failures
- 104
- 105 System log
- 106
- 107 Nov 14 02:41:35 fseventsd: requested timestamp is prior to the earliest log file. setting event-id to zero
- 108 Nov 14 02:42:01 fseventsd: requested timestamp is prior to the earliest log file. setting event-id to zero
- 109 Nov 14 02:43:37 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
- 110 Nov 14 02:43:39 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
- 111 Nov 14 02:43:56 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
- 112 Nov 14 02:44:17 fseventsd: requested timestamp is prior to the earliest log file. setting event-id to zero
- 113 Nov 14 02:44:17 fseventsd: requested timestamp is prior to the earliest log file. setting event-id to zero
- 114 Nov 14 02:44:17 fseventsd: requested timestamp is prior to the earliest log file. setting event-id to zero
- 115 Nov 14 02:44:17 fseventsd: requested timestamp is prior to the earliest log file. setting event-id to zero
- 116 Nov 14 02:44:56 Safari: tcp_connection_tls_session_error_callback_imp 279 __tcp_connection_tls_session_callback_write_block_invoke.434 error 22
- 117 Nov 14 02:46:09 WindowServer: disable_update_timeout: UI updates were forcibly disabled by application "Little Snitch Agent" for over 1.00 seconds. Server has re-enabled them.
- 118 Nov 14 02:47:50 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
- 119 Nov 14 02:47:51 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
- 120 Nov 14 02:48:05 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
- 121 Nov 14 02:48:20 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
- 122 Nov 14 02:48:33 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
- 123 Nov 14 02:48:59 WindowServer: disable_update_timeout: UI updates were forcibly disabled by application "Airmail" for over 1.00 seconds. Server has re-enabled them.
- 124 Nov 14 02:50:20 WindowServer: disable_update_timeout: UI updates were forcibly disabled by application "Airmail" for over 1.00 seconds. Server has re-enabled them.
- 125 Nov 14 02:50:23 cloudd: MMCSEngineClientContextGetItemReaderForItem:120 failed getItemReaderForItemCallback
- 126 Nov 14 02:50:28 WindowServer: _CGXRemoveWindowFromWindowMovementGroup: window 0x32 is not attached to window 0x5f
- 127 Nov 14 02:50:38 cloudd: MMCSEngineClientContextGetItemReaderForItem:120 failed getItemReaderForItemCallback
- 128 Nov 14 02:50:38 WindowServer: disable_update_timeout: UI updates were forcibly disabled by application "Airmail" for over 1.00 seconds. Server has re-enabled them.
- 129 Nov 14 02:50:45 cloudd: MMCSEngineClientContextGetItemReaderForItem:120 failed getItemReaderForItemCallback
- 130 Nov 14 02:51:10 cloudd: MMCSEngineClientContextGetItemReaderForItem:120 failed getItemReaderForItemCallback
- 131 Nov 14 02:51:14 cloudd: MMCSEngineClientContextGetItemReaderForItem:120 failed getItemReaderForItemCallback
- 132
- 133 launchd log
- 134
- 135 Nov 14 01:27:26 com.apple.xpc.launchd.domain.pid.virusbarrierd.108: Could not resolve origin of domain. XPC services in this domain's bundle will not be bootstrapped: error = 107: Malformed bundle, taint = missing executable
- 136 Nov 14 01:28:00 com.apple.xpc.launchd.domain.system: Caller not allowed to perform action: SecurityAgent.317, action = legacy spawn, code = 1: Operation not permitted, uid = 92, euid = 92, gid = 92, egid = 92, asid = 100007
- 137 Nov 14 01:28:24 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: path = /System/Library/LaunchAgents/com.apple.CommCenter-osx.plist, caller = loginwindow.121, error = 138: Service cannot be loaded on this hardware
- 138 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.edovia.screens.launcher, error = 119: Service is disabled
- 139 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.lifewaresolutions.DeluxeMoonHDMacHelper, error = 119: Service is disabled
- 140 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = org.tempel.findanyfile.hotkey, error = 119: Service is disabled
- 141 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.eltima.Folx3.FolxScheduleHelper, error = 119: Service is disabled
- 142 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.growl.GrowlLauncher, error = 119: Service is disabled
- 143 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.vinnov.LivingWallpaperHDfreeHelper, error = 119: Service is disabled
- 144 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.vinnov.LivingWeatherHDHelper, error = 119: Service is disabled
- 145 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.microsoft.SkyDriveLauncher, error = 119: Service is disabled
- 146 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.microsoft.OneDriveLauncher, error = 119: Service is disabled
- 147 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.pushbullet.macapp-notifications, error = 119: Service is disabled
- 148 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.apparentsoft.TricksterLauncher, error = 119: Service is disabled
- 149 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.eurosmartz.pushhelper, error = 119: Service is disabled
- 150 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.uglyapps.HocusFocusHelper, error = 119: Service is disabled
- 151 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.microsoft.OneDriveBusinessMacLauncher, error = 119: Service is disabled
- 152 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.eltima.SyncMate.com.eltima.SyncMateService, error = 119: Service is disabled
- 153 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.eltima.tp2.agent, error = 119: Service is disabled
- 154 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.dmitrynikolaev.numi2helper, error = 119: Service is disabled
- 155 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.urbanapps.hourlynews.mac.launcher, error = 119: Service is disabled
- 156 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.sweetpproductions.DesktopUtilityHelper, error = 119: Service is disabled
- 157 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.intego.WashingMachine.ui.helper, error = 119: Service is disabled
- 158 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.if.Amphetamine.LaunchAtLoginHelper, error = 119: Service is disabled
- 159 Nov 14 01:32:22 com.apple.xpc.launchd.user.domain.501.100007.Aqua: Could not import service from caller: caller = otherbsd.342, service = com.devon-technologies.agentexpress, error = 119: Service is disabled
- 160
- 161 Console log
- 162
- 163 Nov 13 01:10:45 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/VLCStreamer_UUID.plist.
- 164 Nov 13 01:14:44 Fantastical 2: Fantastical 2.app (224) launching
- 165 Nov 13 01:14:55 Fantastical 2: System version: Version 10.11.1 (Build 15B42)
- 166 Nov 13 01:14:55 Fantastical 2: DDLog level: 1
- 167 Nov 13 01:14:55 Fantastical 2: Mac App Store
- 168 Nov 13 03:14:28 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/quicklookd_UUID.plist.
- 169 Nov 13 08:35:13 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/com.apple.WebKit.Plugin.64_UUID.plist.
- 170 Nov 13 19:52:27 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/quicklookd_UUID.plist.
- 171 Nov 13 22:52:48 Fantastical 2 Today Widget: Fantastical 2 Today Widget.appex (224) launching
- 172 Nov 13 22:52:59 Fantastical 2 Today Widget: System version: Version 10.11.1 (Build 15B42)
- 173 Nov 13 22:52:59 Fantastical 2 Today Widget: DDLog level: 1
- 174 Nov 13 22:53:00 Fantastical 2 Today Widget: Fantastical 2 Today Widget.appex (224) launching
- 175 Nov 13 22:53:00 Fantastical 2 Today Widget: Fantastical 2 Today Widget.appex (224) launching
- 176 Nov 13 22:53:00 Fantastical 2 Today Widget: System version: Version 10.11.1 (Build 15B42)
- 177 Nov 13 22:53:00 Fantastical 2 Today Widget: System version: Version 10.11.1 (Build 15B42)
- 178 Nov 13 22:53:00 Fantastical 2 Today Widget: DDLog level: 1
- 179 Nov 13 22:53:00 Fantastical 2 Today Widget: DDLog level: 1
- 180 Nov 13 23:04:37 ReportCrash: Failed to write crash history to file:///Users/USER/Library/Application%20Support/CrashReporter/Today_UUID.plist.
- 181 Nov 14 01:39:28 Fantastical 2: Fantastical 2.app (224) launching
- 182 Nov 14 01:39:42 Fantastical 2: System version: Version 10.11.1 (Build 15B42)
- 183 Nov 14 01:39:42 Fantastical 2: DDLog level: 1
- 184 Nov 14 01:39:42 Fantastical 2: Mac App Store
- 185 Nov 14 01:50:22 Fantastical 2 Today Widget: Fantastical 2 Today Widget.appex (224) launching
- 186 Nov 14 01:50:35 Fantastical 2 Today Widget: System version: Version 10.11.1 (Build 15B42)
- 187 Nov 14 01:50:35 Fantastical 2 Today Widget: DDLog level: 1
- 188
- 189 Loaded kernel extensions
- 190
- 191 at.obdev.nke.LittleSnitch (4352)
- 192 com.Cycling74.driver.Soundflower (1.6.7)
- 193 com.globaldelight.driver.Boom2Device (1.1)
- 194 com.kaspersky.kext.klif (3.0.2a39)
- 195 com.kaspersky.nke (1.6.2a12)
- 196 com.paragon-software.filesystems.ntfs (543.0.14)
- 197 com.splashtop.driver.SRXDisplayCard (1.6)
- 198 com.splashtop.driver.SRXFrameBufferConnector (1.6)
- 199 com.techsmith.TACC (1.0.3)
- 200 com.wdc.driver.USB.64.10.9 (1.0.1)
- 201
- 202 System services loaded
- 203
- 204 at.obdev.littlesnitchd
- 205 com.adobe.fpsaud
- 206 com.ambrosiasw.ambrosiaaudiosupporthelper.daemon
- 207 com.apple.AccountPolicyHelper
- 208 com.apple.AmbientDisplayAgent
- 209 com.apple.CodeSigningHelper
- 210 com.apple.Kerberos.kdc
- 211 - status: 1
- 212 com.apple.MobileFileIntegrity
- 213 com.apple.PerformanceAnalysis.animationperfd
- 214 com.apple.aslmanager
- 215 com.apple.audio.systemsoundserverd
- 216 com.apple.awdd
- 217 com.apple.cache_delete
- 218 com.apple.coreduetd
- 219 com.apple.coresymbolicationd
- 220 com.apple.ctkd
- 221 com.apple.diagnosticd
- 222 com.apple.emond.aslmanager
- 223 com.apple.icloud.findmydeviced
- 224 com.apple.iconservices.iconservicesagent
- 225 com.apple.iconservices.iconservicesd
- 226 com.apple.ifdreader
- 227 com.apple.installd
- 228 com.apple.logd
- 229 - status: 1
- 230 com.apple.nehelper
- 231 com.apple.networkd_privileged
- 232 com.apple.nsurlsessiond_privileged
- 233 com.apple.nsurlstoraged
- 234 com.apple.sandboxd
- 235 com.apple.secinitd
- 236 com.apple.softwareupdated
- 237 com.apple.sysmond
- 238 com.apple.tccd.system
- 239 com.apple.watchdogd
- 240 com.apple.wdhelper
- 241 com.apple.xpc.smd
- 242 com.bresink.system.securityagent3a
- 243 com.chungwasoft.shimo.helper
- 244 com.disconnect.networklistener
- 245 com.edovia.screensconnect.daemon
- 246 com.eltima.ElmediaPlayer.daemon
- 247 com.feingeist.shimo.helper
- 248 com.fitbit.galileod
- 249 com.github.GitHub.GHInstallCLI
- 250 com.intego.WashingMachine.service
- 251 com.intego.commonservices.daemon.integod
- 252 com.intego.commonservices.daemon.taskmanager
- 253 com.intego.commonservices.icalserver
- 254 com.intego.commonservices.metrics.kschecker
- 255 com.intego.netupdate.daemon
- 256 com.intego.virusbarrier.daemon
- 257 com.intego.virusbarrier.daemon.emlparser
- 258 com.intego.virusbarrier.daemon.logger
- 259 com.intego.virusbarrier.daemon.scanner
- 260 com.iobit.AMCDaemon
- 261 com.maintain.cocktail.scheduler
- 262 com.malwarebytes.MBAMHelperTool
- 263 com.microsoft.office.licensing.helper
- 264 com.microsoft.office.licensingV2.helper
- 265 com.oracle.java.Helper-Tool
- 266 com.paragon.NTFS.launch
- 267 com.sibersystems.GsRunner-gvantass
- 268 - status: -15
- 269 com.soma-zone.LaunchControl.Helper
- 270 com.speedtools.scheduleagent
- 271 com.splashtop.streamer-daemon
- 272 com.splashtop.streamer-srioframebuffer
- 273 com.surteesstudios.Bartender.BartenderInstallHelper
- 274 com.tunabellysoftware.TGFanHelper
- 275 comp.text.tex.distribution.Helper
- 276 gs-server
- 277 org.cindori.CCAuth
- 278 org.gpgtools.gpgmail.uuid-patcher
- 279 org.macosforge.xquartz.privileged_startx
- 280
- 281 System services disabled
- 282
- 283 com.apple.security.FDERecoveryAgent
- 284 com.apple.mtmfs
- 285
- 286 Login services loaded
- 287
- 288 2BUA8C4S2C.com.agilebits.onepassword-osx-helper
- 289 at.obdev.LittleSnitchUIAgent
- 290 com.Monity.Helper
- 291 com.adobe.ARM.UUID
- 292 com.amazon.music
- 293 com.apple.AirPlayUIAgent
- 294 com.apple.AssetCacheLocatorService
- 295 com.apple.CallHistoryPluginHelper
- 296 com.apple.CallHistorySyncHelper
- 297 com.apple.EscrowSecurityAlert
- 298 com.apple.Maps.mapspushd
- 299 com.apple.Safari.SafeBrowsing.Service
- 300 com.apple.SafariCloudHistoryPushAgent
- 301 com.apple.SafariNotificationAgent
- 302 com.apple.Spotlight
- 303 com.apple.akd
- 304 com.apple.cdpd
- 305 com.apple.cloudd
- 306 com.apple.cloudphotosd
- 307 com.apple.cmfsyncagent
- 308 com.apple.coreservices.appleid.authentication
- 309 com.apple.coreservices.uiagent
- 310 com.apple.followupd
- 311 com.apple.gamed
- 312 com.apple.icloud.fmfd
- 313 com.apple.iconservices.iconservicesagent
- 314 com.apple.pbs
- 315 com.apple.printtool.agent
- 316 com.apple.recentsd
- 317 com.apple.reversetemplated
- 318 com.apple.scopedbookmarksagent.xpc
- 319 com.apple.soagent
- 320 com.apple.spindump_agent
- 321 com.apple.spotlight.IndexAgent
- 322 com.apple.suggestd
- 323 com.apple.swcd
- 324 com.apple.telephonyutilities.callservicesd
- 325 com.apple.xpc.loginitemregisterd
- 326 com.couchpotato.movies
- 327 com.dayoneapp.dayone-agent
- 328 com.ecamm.iglasses3agent
- 329 com.ecamm.printopia
- 330 com.eltima.tp2.kicker
- 331 com.erikhinterbichler.HeraldLaunchAgent
- 332 com.flexibits.fantastical2.mac.launcher
- 333 com.globaldelight.Boom2Daemon
- 334 com.google.keystone.system.agent
- 335 com.growl.HardwareGrowlerLauncher
- 336 com.intego.commonservices.integomenu
- 337 com.intego.commonservices.taskmanager
- 338 com.intego.commonservices.uninstaller
- 339 com.intego.netupdate.agent
- 340 com.intego.virusbarrier.alert
- 341 com.iobit.MacBooster-mini
- 342 - status: 78
- 343 com.iobit.iosMonitor
- 344 com.junecloud.mac.Deliveries.Launcher
- 345 com.littleknownsoftware.MailPluginTool-Startup
- 346 com.maintain.PurgeInactiveMemory
- 347 - status: 1
- 348 com.maintain.ShowUserLibraryDirectory
- 349 com.maintain.SystemEvents
- 350 com.oracle.java.Java-Updater
- 351 com.paragon-software.NTFS.fsnotifyagent
- 352 com.paragon.updater
- 353 com.robohippo.HippoConnectAgent
- 354 com.sickbeard.tv
- 355 com.splashtop.streamer-for-user
- 356 com.spotify.webhelper
- 357 com.techsmith.snagit.SnagitLaunchAtLogin
- 358 com.valvesoftware.steamclean
- 359 de.martinlexow.TheineHelperObjC
- 360 it.danilotorrisi.command-c-osx-helper
- 361 net.culater.SIMBL.Agent
- 362 org.gpgtools.Libmacgpg.xpc
- 363 org.gpgtools.gpgmail.enable-bundles
- 364 org.gpgtools.gpgmail.updater
- 365 org.gpgtools.gpgmail.user-uuid-patcher
- 366 org.gpgtools.macgpg2.fix
- 367 org.gpgtools.macgpg2.shutdown-gpg-agent
- 368 org.gpgtools.macgpg2.updater
- 369 org.macosforge.xquartz.startx
- 370
- 371 Login services disabled
- 372
- 373 com.sweetpproductions.DesktopUtilityHelper
- 374 com.itsabouttime.pinterestHelper
- 375 com.fiplab.NotesTab-Helper
- 376 com.microsoft.OneDriveLauncher
- 377 com.uglyapps.HocusFocusHelper
- 378
- 379 User services loaded
- 380
- 381 com.apple.AddressBook.ContactsAccountsService
- 382 com.apple.BKAgentService
- 383 com.apple.CloudPhotosConfiguration
- 384 com.apple.InputMethodKit.TextReplacementService
- 385 com.apple.ViewBridgeAuxiliary
- 386 com.apple.hiservices-xpcservice
- 387 com.apple.iCloudHelper
- 388 com.apple.imdpersistence.IMDPersistenceAgent
- 389 com.apple.lakitu
- 390 com.apple.pluginkit.pkd
- 391 com.apple.secinitd
- 392 com.apple.security.cloudkeychainproxy3
- 393 com.apple.tccd
- 394
- 395 User services disabled
- 396
- 397 com.sweetpproductions.DesktopUtilityHelper
- 398 com.itsabouttime.pinterestHelper
- 399 com.fiplab.NotesTab-Helper
- 400 com.microsoft.OneDriveLauncher
- 401 com.uglyapps.HocusFocusHelper
- 402
- 403 Startup items
- 404
- 405 /Library/StartupItems/Cocktail/StartupParameters.plist
- 406
- 407 Contents of /Library/LaunchAgents/at.obdev.LittleSnitchUIAgent.plist
- 408 - mod date: Sep 26 08:08:25 2015
- 409 - size (B): 464
- 410 - checksum: 2014742307
- 411
- 412 <?xml version="1.0" encoding="UTF-8"?>
- 413 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 414 <plist version="1.0">
- 415 <dict>
- 416 <key>KeepAlive</key>
- 417 <true/>
- 418 <key>Label</key>
- 419 <string>at.obdev.LittleSnitchUIAgent</string>
- 420 <key>ProgramArguments</key>
- 421 <array>
- 422 <string>/Library/Little Snitch/Little Snitch Agent.app/Contents/MacOS/Little Snitch Agent</string>
- 423 </array>
- 424 <key>RunAtLoad</key>
- 425 <true/>
- 426 </dict>
- 427 </plist>
- 428
- 429 Contents of /Library/LaunchAgents/com.Monity.Helper.plist
- 430 - mod date: Aug 12 08:11:03 2015
- 431 - size (B): 450
- 432 - checksum: 891655393
- 433
- 434 <?xml version="1.0" encoding="UTF-8"?>
- 435 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 436 <plist version="1.0">
- 437 <dict>
- 438 <key>Label</key>
- 439 <string>com.Monity.Helper</string>
- 440 <key>ProgramArguments</key>
- 441 <array>
- 442 <string>/Library/PrivilegedHelperTools/Monity Helper.app/Contents/MacOS/Monity Helper</string>
- 443 </array>
- 444 <key>RunAtLoad</key>
- 445 <true/>
- 446 <key>KeepAlive</key>
- 447 <false/>
- 448 </dict>
- 449 </plist>
- 450
- 451 Contents of /Library/LaunchAgents/com.ecamm.iglasses3agent.plist
- 452 - mod date: Sep 19 08:14:08 2015
- 453 - size (B): 483
- 454 - checksum: 4208922684
- 455
- 456 <?xml version="1.0" encoding="UTF-8"?>
- 457 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 458 <plist version="1.0">
- 459 <dict>
- 460 <key>KeepAlive</key>
- 461 <true/>
- 462 <key>Label</key>
- 463 <string>com.ecamm.iglasses3agent</string>
- 464 <key>LimitLoadToSessionType</key>
- 465 <string>Aqua</string>
- 466 <key>Program</key>
- 467 <string>/Library/Application Support/iGlasses3/iGlasses.app/Contents/MacOS/iGlasses</string>
- 468 <key>RunAtLoad</key>
- 469 <true/>
- 470 </dict>
- 471 </plist>
- 472
- 473 Contents of /Library/LaunchAgents/com.intego.commonservices.integomenu.plist
- 474 - mod date: Dec 13 09:52:37 2013
- 475 - size (B): 691
- 476 - checksum: 1276779959
- 477
- 478 <?xml version="1.0" encoding="UTF-8"?>
- 479 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 480 <plist version="1.0">
- 481 <dict>
- 482 <key>KeepAlive</key>
- 483 <dict>
- 484 <key>SuccessfulExit</key>
- 485 <false/>
- 486 </dict>
- 487 <key>Label</key>
- 488 <string>com.intego.commonservices.integomenu</string>
- 489 <key>LimitLoadToSessionType</key>
- 490 <string>Aqua</string>
- 491 <key>ProgramArguments</key>
- 492 <array>
- 493 <string>/Library/Intego/commonservices.bundle/Contents/MacOS/IntegoMenu.app/Contents/MacOS/IntegoMenu</string>
- 494 </array>
- 495 <key>RunAtLoad</key>
- 496 <true/>
- 497 <key>MachServices</key>
- 498 <dict>
- 499 <key>com.intego.commonservices.integomenu</key>
- 500 <true/>
- 501 </dict>
- 502 </dict>
- 503
- 504 ...and 1 more line(s)
- 505
- 506 Contents of /Library/LaunchAgents/com.intego.commonservices.taskmanager.plist
- 507 - mod date: Nov 12 09:59:52 2013
- 508 - size (B): 586
- 509 - checksum: 2770223182
- 510
- 511 <?xml version="1.0" encoding="UTF-8"?>
- 512 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 513 <plist version="1.0">
- 514 <dict>
- 515 <key>KeepAlive</key>
- 516 <false/>
- 517 <key>LimitLoadToSessionType</key>
- 518 <string>Aqua</string>
- 519 <key>WatchPaths</key>
- 520 <array>
- 521 <string>/Library/Intego/TaskManager/.start</string>
- 522 </array>
- 523 <key>Label</key>
- 524 <string>com.intego.commonservices.taskmanager</string>
- 525 <key>ProgramArguments</key>
- 526 <array>
- 527 <string>/Library/Intego/TaskManager/TM_Notifier.app/Contents/MacOS/TM_Notifier</string>
- 528 </array>
- 529 </dict>
- 530 </plist>
- 531
- 532 Contents of /Library/LaunchAgents/com.intego.commonservices.uninstaller.plist
- 533 - mod date: Dec 3 22:04:24 2013
- 534 - size (B): 609
- 535 - checksum: 190387482
- 536
- 537 <?xml version="1.0" encoding="UTF-8"?>
- 538 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 539 <plist version="1.0">
- 540 <dict>
- 541 <key>KeepAlive</key>
- 542 <false/>
- 543 <key>LimitLoadToSessionType</key>
- 544 <string>Aqua</string>
- 545 <key>WatchPaths</key>
- 546 <array>
- 547 <string>/Applications/</string>
- 548 <string>/Applications/Intego/</string>
- 549 </array>
- 550 <key>Label</key>
- 551 <string>com.intego.commonservices.uninstaller</string>
- 552 <key>ProgramArguments</key>
- 553 <array>
- 554 <string>/Library/Intego/Intego Uninstaller.app/Contents/MacOS/Intego Uninstaller</string>
- 555 </array>
- 556 </dict>
- 557 </plist>
- 558
- 559 Contents of /Library/LaunchAgents/com.intego.netupdate.agent.plist
- 560 - mod date: Jun 29 08:50:18 2015
- 561 - size (B): 538
- 562 - checksum: 2663754357
- 563
- 564 <?xml version="1.0" encoding="UTF-8"?>
- 565 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 566 <plist version="1.0">
- 567 <dict>
- 568 <key>Label</key>
- 569 <string>com.intego.netupdate.agent</string>
- 570 <key>LimitLoadToSessionType</key>
- 571 <array>
- 572 <string>LoginWindow</string>
- 573 <string>Aqua</string>
- 574 </array>
- 575 <key>KeepAlive</key>
- 576 <true/>
- 577 <key>ProgramArguments</key>
- 578 <array>
- 579 <string>/Library/PrivilegedHelperTools/NetUpdateAgent.app/Contents/MacOS/NetUpdateAgent</string>
- 580 </array>
- 581 </dict>
- 582 </plist>
- 583
- 584 Contents of /Library/LaunchAgents/com.intego.virusbarrier.alert.plist
- 585 - mod date: Sep 6 11:38:57 2013
- 586 - size (B): 741
- 587 - checksum: 397299966
- 588
- 589 <?xml version="1.0" encoding="UTF-8"?>
- 590 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 591 <plist version="1.0">
- 592 <dict>
- 593 <key>Label</key>
- 594 <string>com.intego.virusbarrier.alert</string>
- 595 <key>LimitLoadToSessionType</key>
- 596 <string>Aqua</string>
- 597 <key>RunAtLoad</key>
- 598 <true/>
- 599 <key>WatchPaths</key>
- 600 <array>
- 601 <string>/Library/Intego/virusbarrier.bundle/Contents/Resources/start_alert</string>
- 602 </array>
- 603 <key>ProgramArguments</key>
- 604 <array>
- 605 <string>/Library/Intego/virusbarrier.bundle/Contents/MacOS/VirusBarrier Alert.app/Contents/MacOS/VirusBarrier Alert</string>
- 606 </array>
- 607 <key>MachServices</key>
- 608 <dict>
- 609 <key>com.intego.virusbarrier.alert</key>
- 610 <true/>
- 611 </dict>
- 612 </dict>
- 613 </plist>
- 614
- 615 Contents of /Library/LaunchAgents/com.maintain.LogOut.plist
- 616 - mod date: Oct 5 06:35:31 2015
- 617 - size (B): 904
- 618 - checksum: 2486542021
- 619
- 620 <?xml version="1.0" encoding="UTF-8"?>
- 621 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 622 <plist version="1.0">
- 623 <dict>
- 624 <key>Disabled</key>
- 625 <true/>
- 626 <key>Label</key>
- 627 <string>com.maintain.LogOut</string>
- 628 <key>ProgramArguments</key>
- 629 <array>
- 630 <string>/usr/bin/osascript</string>
- 631 <string>-e</string>
- 632 <string>delay 3</string>
- 633 <string>-e</string>
- 634 <string>try</string>
- 635 <string>-e</string>
- 636 <string>do shell script "killall Cocktail"</string>
- 637 <string>-e</string>
- 638 <string>end try</string>
- 639 <string>-e</string>
- 640 <string>ignoring application responses</string>
- 641 <string>-e</string>
- 642 <string>try</string>
- 643 <string>-e</string>
- 644 <string>tell application "System Events" to log out</string>
- 645
- 646 ...and 7 more line(s)
- 647
- 648 Contents of /Library/LaunchAgents/com.maintain.PurgeInactiveMemory.plist
- 649 - Apple binary property list
- 650 - mod date: Mar 5 04:02:59 2015
- 651 - size (B): 181
- 652 - checksum: 603737813
- 653
- 654 Dict {
- 655 ProgramArguments = Array {
- 656 /usr/sbin/purge
- 657 }
- 658 StartInterval = 900
- 659 Disabled = false
- 660 RunAtLoad = false
- 661 Label = com.maintain.PurgeInactiveMemory
- 662 }
- 663
- 664 Contents of /Library/LaunchAgents/com.maintain.Restart.plist
- 665 - mod date: Jan 19 23:17:16 2015
- 666 - size (B): 905
- 667 - checksum: 1856196442
- 668
- 669 <?xml version="1.0" encoding="UTF-8"?>
- 670 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 671 <plist version="1.0">
- 672 <dict>
- 673 <key>Disabled</key>
- 674 <true/>
- 675 <key>Label</key>
- 676 <string>com.maintain.Restart</string>
- 677 <key>ProgramArguments</key>
- 678 <array>
- 679 <string>/usr/bin/osascript</string>
- 680 <string>-e</string>
- 681 <string>delay 3</string>
- 682 <string>-e</string>
- 683 <string>try</string>
- 684 <string>-e</string>
- 685 <string>do shell script "killall Cocktail"</string>
- 686 <string>-e</string>
- 687 <string>end try</string>
- 688 <string>-e</string>
- 689 <string>ignoring application responses</string>
- 690 <string>-e</string>
- 691 <string>try</string>
- 692 <string>-e</string>
- 693 <string>tell application "System Events" to restart</string>
- 694
- 695 ...and 7 more line(s)
- 696
- 697 Contents of /Library/LaunchAgents/com.maintain.ShutDown.plist
- 698 - mod date: Jan 19 23:17:17 2015
- 699 - size (B): 908
- 700 - checksum: 2131448796
- 701
- 702 <?xml version="1.0" encoding="UTF-8"?>
- 703 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 704 <plist version="1.0">
- 705 <dict>
- 706 <key>Disabled</key>
- 707 <true/>
- 708 <key>Label</key>
- 709 <string>com.maintain.ShutDown</string>
- 710 <key>ProgramArguments</key>
- 711 <array>
- 712 <string>/usr/bin/osascript</string>
- 713 <string>-e</string>
- 714 <string>delay 3</string>
- 715 <string>-e</string>
- 716 <string>try</string>
- 717 <string>-e</string>
- 718 <string>do shell script "killall Cocktail"</string>
- 719 <string>-e</string>
- 720 <string>end try</string>
- 721 <string>-e</string>
- 722 <string>ignoring application responses</string>
- 723 <string>-e</string>
- 724 <string>try</string>
- 725 <string>-e</string>
- 726 <string>tell application "System Events" to shut down</string>
- 727
- 728 ...and 7 more line(s)
- 729
- 730 Contents of /Library/LaunchAgents/com.maintain.Sleep.plist
- 731 - mod date: Oct 5 06:35:35 2015
- 732 - size (B): 901
- 733 - checksum: 2684026111
- 734
- 735 <?xml version="1.0" encoding="UTF-8"?>
- 736 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 737 <plist version="1.0">
- 738 <dict>
- 739 <key>Disabled</key>
- 740 <true/>
- 741 <key>Label</key>
- 742 <string>com.maintain.Sleep</string>
- 743 <key>ProgramArguments</key>
- 744 <array>
- 745 <string>/usr/bin/osascript</string>
- 746 <string>-e</string>
- 747 <string>delay 3</string>
- 748 <string>-e</string>
- 749 <string>try</string>
- 750 <string>-e</string>
- 751 <string>do shell script "killall Cocktail"</string>
- 752 <string>-e</string>
- 753 <string>end try</string>
- 754 <string>-e</string>
- 755 <string>ignoring application responses</string>
- 756 <string>-e</string>
- 757 <string>try</string>
- 758 <string>-e</string>
- 759 <string>tell application "System Events" to sleep</string>
- 760
- 761 ...and 7 more line(s)
- 762
- 763 Contents of /Library/LaunchAgents/com.maintain.SystemEvents.plist
- 764 - mod date: Jan 19 23:17:17 2015
- 765 - size (B): 486
- 766 - checksum: 1297325733
- 767
- 768 <?xml version="1.0" encoding="UTF-8"?>
- 769 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 770 <plist version="1.0">
- 771 <dict>
- 772 <key>Disabled</key>
- 773 <false/>
- 774 <key>KeepAlive</key>
- 775 <true/>
- 776 <key>Label</key>
- 777 <string>com.maintain.SystemEvents</string>
- 778 <key>ProgramArguments</key>
- 779 <array>
- 780 <string>/System/Library/CoreServices/System Events.app/Contents/MacOS/System Events</string>
- 781 </array>
- 782 <key>RunAtLoad</key>
- 783 <true/>
- 784 </dict>
- 785 </plist>
- 786
- 787 Contents of /Library/LaunchAgents/com.oracle.java.Java-Updater.plist
- 788 - mod date: Aug 27 00:29:15 2015
- 789 - size (B): 104
- 790 - checksum: 2656802019
- 791
- 792 <?xml version="1.0" encoding="UTF-8"?>
- 793 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 794 <plist version="1.0">
- 795 <dict>
- 796 <key>Label</key>
- 797 <string>com.oracle.java.Java-Updater</string>
- 798 <key>ProgramArguments</key>
- 799 <array>
- 800 <string>/Library/Internet Plug-Ins/JavaAppletPlugin.plugin/Contents/Resources/Java Updater.app/Contents/MacOS/Java Updater</string>
- 801 <string>-bgcheck</string>
- 802 </array>
- 803 <key>StandardErrorPath</key>
- 804 <string>/dev/null</string>
- 805 <key>StandardOutPath</key>
- 806 <string>/dev/null</string>
- 807 <key>StartCalendarInterval</key>
- 808 <dict>
- 809 <key>Hour</key>
- 810 <integer>4</integer>
- 811 <key>Minute</key>
- 812 <integer>58</integer>
- 813 <key>Weekday</key>
- 814 <integer>4</integer>
- 815 </dict>
- 816 </dict>
- 817
- 818 ...and 1 more line(s)
- 819
- 820 Contents of /Library/LaunchAgents/com.paragon-software.NTFS.fsnotifyagent.plist
- 821 - mod date: Oct 23 05:56:00 2015
- 822 - size (B): 534
- 823 - checksum: 2618589534
- 824
- 825 <?xml version="1.0" encoding="UTF-8"?>
- 826 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 827 <plist version="1.0">
- 828 <dict>
- 829 <key>Label</key>
- 830 <string>com.paragon-software.NTFS.fsnotifyagent</string>
- 831 <key>Program</key>
- 832 <string>/Library/PreferencePanes/ParagonNTFS.prefPane/Contents/Resources/fsnotifyagent.app/Contents/MacOS/fsnotifyagent</string>
- 833 <key>RunAtLoad</key>
- 834 <true/>
- 835 <key>KeepAlive</key>
- 836 <true/>
- 837 <key>LimitLoadToSessionType</key>
- 838 <string>Aqua</string>
- 839 </dict>
- 840 </plist>
- 841
- 842 Contents of /Library/LaunchAgents/com.paragon.updater.plist
- 843 - mod date: Oct 23 05:55:52 2015
- 844 - size (B): 548
- 845 - checksum: 962844124
- 846
- 847 <?xml version="1.0" encoding="UTF-8"?>
- 848 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 849 <plist version="1.0">
- 850 <dict>
- 851 <key>StartInterval</key>
- 852 <integer>86400</integer>
- 853 <key>ProgramArguments</key>
- 854 <array>
- 855 <string>/Library/Application Support/Paragon Updater/Paragon Updater.app/Contents/MacOS/Paragon Updater</string>
- 856 <string>--check</string>
- 857 <string>--delay=30</string>
- 858 </array>
- 859 <key>Label</key>
- 860 <string>com.paragon.updater</string>
- 861 <key>RunAtLoad</key>
- 862 <true/>
- 863 </dict>
- 864 </plist>
- 865
- 866 Contents of /Library/LaunchAgents/com.robohippo.HippoConnectAgent.plist
- 867 - mod date: Jan 7 01:36:51 2014
- 868 - size (B): 692
- 869 - checksum: 440542358
- 870
- 871 <?xml version="1.0" encoding="UTF-8"?>
- 872 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 873 <plist version="1.0">
- 874 <dict>
- 875 <key>GroupName</key>
- 876 <string>wheel</string>
- 877 <key>KeepAlive</key>
- 878 <true/>
- 879 <key>Label</key>
- 880 <string>com.robohippo.HippoConnectAgent</string>
- 881 <key>LimitLoadToSessionType</key>
- 882 <array>
- 883 <string>Aqua</string>
- 884 </array>
- 885 <key>OnDemand</key>
- 886 <false/>
- 887 <key>ProgramArguments</key>
- 888 <array>
- 889 <string>/Library/Application Support/HippoConnect/HippoConnectAgent</string>
- 890 <string>-p</string>
- 891 <string>c0nn0r</string>
- 892 </array>
- 893 <key>RunAtLoad</key>
- 894 <true/>
- 895 <key>UserName</key>
- 896
- 897 ...and 3 more line(s)
- 898
- 899 Contents of /Library/LaunchAgents/com.splashtop.streamer-for-root.plist
- 900 - mod date: Sep 23 04:16:29 2015
- 901 - size (B): 664
- 902 - checksum: 2759554987
- 903
- 904 <?xml version="1.0" encoding="UTF-8"?>
- 905 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 906 <plist version="1.0">
- 907 <dict>
- 908 <key>Label</key>
- 909 <string>com.splashtop.streamer-for-root</string>
- 910 <key>LimitLoadToSessionType</key>
- 911 <array>
- 912 <string>LoginWindow</string>
- 913 </array>
- 914 <key>KeepAlive</key>
- 915 <dict>
- 916 <key>SuccessfulExit</key>
- 917 <false/>
- 918 <key>AfterInitialDemand</key>
- 919 <false/>
- 920 </dict>
- 921 <key>RunAtLoad</key>
- 922 <true/>
- 923 <key>ProgramArguments</key>
- 924 <array>
- 925 <string>/Applications/Splashtop Streamer.app/Contents/MacOS/Splashtop Streamer</string>
- 926 <string>RunAtPreLogin</string>
- 927 </array>
- 928 </dict>
- 929
- 930 ...and 1 more line(s)
- 931
- 932 Contents of /Library/LaunchAgents/com.splashtop.streamer-for-user.plist
- 933 - mod date: Sep 23 04:16:29 2015
- 934 - size (B): 654
- 935 - checksum: 522106556
- 936
- 937 <?xml version="1.0" encoding="UTF-8"?>
- 938 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 939 <plist version="1.0">
- 940 <dict>
- 941 <key>Label</key>
- 942 <string>com.splashtop.streamer-for-user</string>
- 943 <key>LimitLoadToSessionType</key>
- 944 <array>
- 945 <string>Aqua</string>
- 946 </array>
- 947 <key>KeepAlive</key>
- 948 <dict>
- 949 <key>SuccessfulExit</key>
- 950 <false/>
- 951 <key>AfterInitialDemand</key>
- 952 <false/>
- 953 </dict>
- 954 <key>RunAtLoad</key>
- 955 <true/>
- 956 <key>ProgramArguments</key>
- 957 <array>
- 958 <string>/Applications/Splashtop Streamer.app/Contents/MacOS/Splashtop Streamer</string>
- 959 <string>RunAtLogin</string>
- 960 </array>
- 961 </dict>
- 962
- 963 ...and 1 more line(s)
- 964
- 965 Contents of /Library/LaunchAgents/org.gpgtools.Libmacgpg.xpc.plist
- 966 - mod date: Sep 23 12:46:49 2015
- 967 - size (B): 556
- 968 - checksum: 2633516353
- 969
- 970 <?xml version="1.0" encoding="UTF-8"?>
- 971 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 972 <plist version="1.0">
- 973 <dict>
- 974 <key>EnableTransactions</key>
- 975 <true/>
- 976 <key>KeepAlive</key>
- 977 <false/>
- 978 <key>Label</key>
- 979 <string>org.gpgtools.Libmacgpg.xpc</string>
- 980 <key>MachServices</key>
- 981 <dict>
- 982 <key>org.gpgtools.Libmacgpg.xpc_OpenStep</key>
- 983 <true/>
- 984 </dict>
- 985 <key>ProgramArguments</key>
- 986 <array>
- 987 <string>/Library/Application Support/GPGTools/org.gpgtools.Libmacgpg.xpc</string>
- 988 </array>
- 989 </dict>
- 990 </plist>
- 991
- 992 Contents of /Library/LaunchAgents/org.gpgtools.gpgmail.enable-bundles.plist
- 993 - mod date: Mar 8 08:03:00 2015
- 994 - size (B): 478
- 995 - checksum: 4256729205
- 996
- 997 <?xml version="1.0" encoding="UTF-8"?>
- 998 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 999 <plist version="1.0">
- 1000 <dict>
- 1001 <key>Label</key>
- 1002 <string>org.gpgtools.gpgmail.enable-bundles</string>
- 1003 <key>ProgramArguments</key>
- 1004 <array>
- 1005 <string>/Library/Application Support/GPGTools/uuid-patcher</string>
- 1006 <string>enable-bundles</string>
- 1007 </array>
- 1008 <key>RunAtLoad</key>
- 1009 <true/>
- 1010 <key>KeepAlive</key>
- 1011 <false/>
- 1012 </dict>
- 1013 </plist>
- 1014
- 1015 Contents of /Library/LaunchAgents/org.gpgtools.gpgmail.patch-uuid-user.plist
- 1016 - mod date: Mar 8 08:03:00 2015
- 1017 - size (B): 415
- 1018 - checksum: 2367346596
- 1019
- 1020 <?xml version="1.0" encoding="UTF-8"?>
- 1021 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1022 <plist version="1.0">
- 1023 <dict>
- 1024 <key>Label</key>
- 1025 <string>org.gpgtools.gpgmail.user-uuid-patcher</string>
- 1026 <key>Program</key>
- 1027 <string>/Library/Application Support/GPGTools/uuid-patcher</string>
- 1028 <key>RunAtLoad</key>
- 1029 <true/>
- 1030 <key>KeepAlive</key>
- 1031 <false/>
- 1032 </dict>
- 1033 </plist>
- 1034
- 1035 Contents of /Library/LaunchAgents/org.gpgtools.gpgmail.updater.plist
- 1036 - mod date: Sep 23 11:00:35 2015
- 1037 - size (B): 493
- 1038 - checksum: 2804634747
- 1039
- 1040 <?xml version="1.0" encoding="UTF-8"?>
- 1041 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1042 <plist version="1.0">
- 1043 <dict>
- 1044 <key>KeepAlive</key>
- 1045 <false/>
- 1046 <key>StartInterval</key>
- 1047 <integer>10800</integer>
- 1048 <key>Label</key>
- 1049 <string>org.gpgtools.gpgmail.updater</string>
- 1050 <key>ProgramArguments</key>
- 1051 <array>
- 1052 <string>/Library/Application Support/GPGTools/GPGMail_Updater.app/Contents/MacOS/GPGMail_Updater</string>
- 1053 </array>
- 1054 </dict>
- 1055 </plist>
- 1056
- 1057 Contents of /Library/LaunchAgents/org.gpgtools.macgpg2.fix.plist
- 1058 - mod date: Mar 8 08:03:00 2015
- 1059 - size (B): 417
- 1060 - checksum: 3267088882
- 1061
- 1062 <?xml version="1.0" encoding="UTF-8"?>
- 1063 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1064 <plist version="1.0">
- 1065 <dict>
- 1066 <key>KeepAlive</key>
- 1067 <false/>
- 1068 <key>Label</key>
- 1069 <string>org.gpgtools.macgpg2.fix</string>
- 1070 <key>ProgramArguments</key>
- 1071 <array>
- 1072 <string>/usr/local/MacGPG2/libexec/fixGpgHome</string>
- 1073 </array>
- 1074 <key>RunAtLoad</key>
- 1075 <true/>
- 1076 </dict>
- 1077 </plist>
- 1078
- 1079 Contents of /Library/LaunchAgents/org.gpgtools.macgpg2.shutdown-gpg-agent.plist
- 1080 - mod date: Mar 8 08:03:00 2015
- 1081 - size (B): 552
- 1082 - checksum: 3222670079
- 1083
- 1084 <?xml version="1.0" encoding="UTF-8"?>
- 1085 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1086 <plist version="1.0">
- 1087 <dict>
- 1088 <key>Label</key>
- 1089 <string>org.gpgtools.macgpg2.shutdown-gpg-agent</string>
- 1090 <key>Program</key>
- 1091 <string>/usr/local/MacGPG2/libexec/shutdown-gpg-agent</string>
- 1092 <key>RunAtLoad</key>
- 1093 <true/>
- 1094 <key>KeepAlive</key>
- 1095 <dict>
- 1096 <key>SuccessfulExit</key>
- 1097 <true/>
- 1098 </dict>
- 1099 <key>ExitTimeOut</key>
- 1100 <integer>5</integer>
- 1101 </dict>
- 1102 </plist>
- 1103
- 1104 Contents of /Library/LaunchAgents/org.gpgtools.macgpg2.updater.plist
- 1105 - mod date: Mar 8 08:03:00 2015
- 1106 - size (B): 482
- 1107 - checksum: 1275281879
- 1108
- 1109 <?xml version="1.0" encoding="UTF-8"?>
- 1110 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1111 <plist version="1.0">
- 1112 <dict>
- 1113 <key>KeepAlive</key>
- 1114 <false/>
- 1115 <key>StartInterval</key>
- 1116 <integer>10800</integer>
- 1117 <key>Label</key>
- 1118 <string>org.gpgtools.macgpg2.updater</string>
- 1119 <key>ProgramArguments</key>
- 1120 <array>
- 1121 <string>/usr/local/MacGPG2/libexec/MacGPG2_Updater.app/Contents/MacOS/MacGPG2_Updater</string>
- 1122 </array>
- 1123 </dict>
- 1124 </plist>
- 1125
- 1126 Contents of /Library/LaunchDaemons/at.obdev.littlesnitchd.plist
- 1127 - mod date: Sep 26 08:08:23 2015
- 1128 - size (B): 631
- 1129 - checksum: 4174275850
- 1130
- 1131 <?xml version="1.0" encoding="UTF-8"?>
- 1132 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1133 <plist version="1.0">
- 1134 <dict>
- 1135 <key>KeepAlive</key>
- 1136 <true/>
- 1137 <key>Label</key>
- 1138 <string>at.obdev.littlesnitchd</string>
- 1139 <key>ProgramArguments</key>
- 1140 <array>
- 1141 <string>/Library/Little Snitch/Little Snitch Daemon.bundle/Contents/MacOS/Little Snitch Daemon</string>
- 1142 </array>
- 1143 <key>RunAtLoad</key>
- 1144 <true/>
- 1145 <key>StandardErrorPath</key>
- 1146 <string>/Library/Logs/LittleSnitchDaemon.log</string>
- 1147 <key>StandardOutPath</key>
- 1148 <string>/Library/Logs/LittleSnitchDaemon.log</string>
- 1149 </dict>
- 1150 </plist>
- 1151
- 1152 Contents of /Library/LaunchDaemons/com.ambrosiasw.ambrosiaaudiosupporthelper.daemon.plist
- 1153 - mod date: Jan 4 14:03:17 2013
- 1154 - size (B): 780
- 1155 - checksum: 1980407752
- 1156
- 1157 <?xml version="1.0" encoding="UTF-8"?>
- 1158 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1159 <plist version="1.0">
- 1160 <dict>
- 1161 <key>Label</key>
- 1162 <string>com.ambrosiasw.ambrosiaaudiosupporthelper.daemon</string>
- 1163 <key>ProgramArguments</key>
- 1164 <array>
- 1165 <string>/System/Library/Extensions/AmbrosiaAudioSupport.kext/Contents/MacOS/ambrosiaaudiosupporthelper</string>
- 1166 </array>
- 1167 <key>KeepAlive</key>
- 1168 <false/>
- 1169 <key>Disabled</key>
- 1170 <false/>
- 1171 <key>LaunchEvents</key>
- 1172 <dict>
- 1173 <key>com.apple.iokit.matching</key>
- 1174 <dict>
- 1175 <key>AmbrosiaAudioSupport</key>
- 1176 <dict>
- 1177 <key>IOMatchLaunchStream</key>
- 1178 <true/>
- 1179 <key>IOProviderClass</key>
- 1180 <string>com_AmbrosiaSW_AudioSupport</string>
- 1181 </dict>
- 1182
- 1183 ...and 4 more line(s)
- 1184
- 1185 Contents of /Library/LaunchDaemons/com.bresink.system.securityagent3a.plist
- 1186 - mod date: Feb 14 01:51:09 2014
- 1187 - size (B): 725
- 1188 - checksum: 1758205685
- 1189
- 1190 <?xml version="1.0" encoding="UTF-8"?>
- 1191 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1192 <plist version="1.0">
- 1193 <dict>
- 1194 <key>Label</key>
- 1195 <string>com.bresink.system.securityagent3a</string>
- 1196 <key>ProgramArguments</key>
- 1197 <array>
- 1198 <string>/Library/PrivilegedHelperTools/com.bresink.system.securityagent3a</string>
- 1199 </array>
- 1200 <key>Sockets</key>
- 1201 <dict>
- 1202 <key>MasterSocket</key>
- 1203 <dict>
- 1204 <key>SockFamily</key>
- 1205 <string>Unix</string>
- 1206 <key>SockPathMode</key>
- 1207 <integer>438</integer>
- 1208 <key>SockPathName</key>
- 1209 <string>/var/run/com.bresink.system.securityagent3a.socket</string>
- 1210 <key>SockType</key>
- 1211 <string>Stream</string>
- 1212 </dict>
- 1213 </dict>
- 1214 </dict>
- 1215
- 1216 ...and 1 more line(s)
- 1217
- 1218 Contents of /Library/LaunchDaemons/com.chungwasoft.shimo.helper.plist
- 1219 - mod date: Aug 6 21:46:45 2015
- 1220 - size (B): 572
- 1221 - checksum: 1712907597
- 1222
- 1223 <?xml version="1.0" encoding="UTF-8"?>
- 1224 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1225 <plist version="1.0">
- 1226 <dict>
- 1227 <key>Label</key>
- 1228 <string>com.chungwasoft.shimo.helper</string>
- 1229 <key>MachServices</key>
- 1230 <dict>
- 1231 <key>com.chungwasoft.shimo.helper</key>
- 1232 <true/>
- 1233 </dict>
- 1234 <key>Program</key>
- 1235 <string>/Library/PrivilegedHelperTools/com.chungwasoft.shimo.helper</string>
- 1236 <key>ProgramArguments</key>
- 1237 <array>
- 1238 <string>/Library/PrivilegedHelperTools/com.chungwasoft.shimo.helper</string>
- 1239 </array>
- 1240 </dict>
- 1241 </plist>
- 1242
- 1243 Contents of /Library/LaunchDaemons/com.disconnect.networklistener.plist
- 1244 - mod date: Jun 22 13:36:03 2015
- 1245 - size (B): 473
- 1246 - checksum: 3599400854
- 1247
- 1248 <?xml version="1.0" encoding="UTF-8"?>
- 1249 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1250 <plist version="1.0">
- 1251 <dict>
- 1252 <key>Label</key>
- 1253 <string>com.disconnect.networklistener</string>
- 1254 <key>ProgramArguments</key>
- 1255 <array>
- 1256 <string>/Library/Application Support/disconnect/changednetwork.sh</string>
- 1257 </array>
- 1258 <key>WatchPaths</key>
- 1259 <array>
- 1260 <string>/private/var/db/dhcpclient/leases/</string>
- 1261 </array>
- 1262 </dict>
- 1263 </plist>
- 1264
- 1265 Contents of /Library/LaunchDaemons/com.edovia.screensconnect.daemon.plist
- 1266 - mod date: Sep 5 07:31:26 2013
- 1267 - size (B): 689
- 1268 - checksum: 4154779426
- 1269
- 1270 <?xml version="1.0" encoding="UTF-8"?>
- 1271 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1272 <plist version="1.0">
- 1273 <dict>
- 1274 <key>Label</key>
- 1275 <string>com.edovia.screensconnect.daemon</string>
- 1276 <key>Disabled</key>
- 1277 <false/>
- 1278 <key>UserName</key>
- 1279 <string>root</string>
- 1280 <key>GroupName</key>
- 1281 <string>wheel</string>
- 1282 <key>Program</key>
- 1283 <string>/Library/PrivilegedHelperTools/screens_connectd</string>
- 1284 <key>RunAtLoad</key>
- 1285 <true/>
- 1286 <key>KeepAlive</key>
- 1287 <dict>
- 1288 <key>SuccessfulExit</key>
- 1289 <true/>
- 1290 <key>PathState</key>
- 1291 <dict>
- 1292 <key>/Library/PreferencePanes/Screens Connect.prefPane</key>
- 1293 <true/>
- 1294 </dict>
- 1295
- 1296 ...and 3 more line(s)
- 1297
- 1298 Contents of /Library/LaunchDaemons/com.eltima.ElmediaPlayer.daemon.plist
- 1299 - mod date: Apr 23 17:41:13 2013
- 1300 - size (B): 537
- 1301 - checksum: 1274124936
- 1302
- 1303 <?xml version="1.0" encoding="UTF-8"?>
- 1304 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1305 <plist version="1.0">
- 1306 <dict>
- 1307 <key>Disabled</key>
- 1308 <false/>
- 1309 <key>KeepAlive</key>
- 1310 <false/>
- 1311 <key>Label</key>
- 1312 <string>com.eltima.ElmediaPlayer.daemon</string>
- 1313 <key>LaunchOnlyOnce</key>
- 1314 <true/>
- 1315 <key>OnDemand</key>
- 1316 <false/>
- 1317 <key>ProgramArguments</key>
- 1318 <array>
- 1319 <string>/Library/Application Support/ElmediaPlayer/empdaemon</string>
- 1320 </array>
- 1321 <key>RunAtLoad</key>
- 1322 <true/>
- 1323 </dict>
- 1324 </plist>
- 1325
- 1326 Contents of /Library/LaunchDaemons/com.feingeist.shimo.helper.plist
- 1327 - mod date: Oct 22 16:41:30 2015
- 1328 - size (B): 564
- 1329 - checksum: 929791203
- 1330
- 1331 <?xml version="1.0" encoding="UTF-8"?>
- 1332 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1333 <plist version="1.0">
- 1334 <dict>
- 1335 <key>Label</key>
- 1336 <string>com.feingeist.shimo.helper</string>
- 1337 <key>MachServices</key>
- 1338 <dict>
- 1339 <key>com.feingeist.shimo.helper</key>
- 1340 <true/>
- 1341 </dict>
- 1342 <key>Program</key>
- 1343 <string>/Library/PrivilegedHelperTools/com.feingeist.shimo.helper</string>
- 1344 <key>ProgramArguments</key>
- 1345 <array>
- 1346 <string>/Library/PrivilegedHelperTools/com.feingeist.shimo.helper</string>
- 1347 </array>
- 1348 </dict>
- 1349 </plist>
- 1350
- 1351 Contents of /Library/LaunchDaemons/com.fitbit.galileod.plist
- 1352 - mod date: Dec 30 21:48:16 2014
- 1353 - size (B): 1169
- 1354 - checksum: 1302035971
- 1355
- 1356 <?xml version="1.0" encoding="UTF-8"?>
- 1357 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1358 <plist version="1.0">
- 1359 <dict>
- 1360 <key>Debug</key>
- 1361 <false/>
- 1362 <key>Disabled</key>
- 1363 <false/>
- 1364 <key>ExitTimeOut</key>
- 1365 <integer>5</integer>
- 1366 <key>GroupName</key>
- 1367 <string>daemon</string>
- 1368 <key>InitGroups</key>
- 1369 <true/>
- 1370 <key>Label</key>
- 1371 <string>com.fitbit.galileod</string>
- 1372 <key>OnDemand</key>
- 1373 <false/>
- 1374 <key>Program</key>
- 1375 <string>/usr/local/bin/galileod</string>
- 1376 <key>ProgramArguments</key>
- 1377 <array>
- 1378 <string>/usr/local/bin/galileod/disable</string>
- 1379 </array>
- 1380 <key>RunAtLoad</key>
- 1381
- 1382 ...and 27 more line(s)
- 1383
- 1384 Contents of /Library/LaunchDaemons/com.github.GitHub.GHInstallCLI.plist
- 1385 - mod date: Nov 6 19:44:19 2014
- 1386 - size (B): 612
- 1387 - checksum: 796956247
- 1388
- 1389 <?xml version="1.0" encoding="UTF-8"?>
- 1390 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1391 <plist version="1.0">
- 1392 <dict>
- 1393 <key>KeepAlive</key>
- 1394 <false/>
- 1395 <key>Label</key>
- 1396 <string>com.github.GitHub.GHInstallCLI</string>
- 1397 <key>MachServices</key>
- 1398 <dict>
- 1399 <key>com.github.GitHub.GHInstallCLI</key>
- 1400 <true/>
- 1401 </dict>
- 1402 <key>Program</key>
- 1403 <string>/Library/PrivilegedHelperTools/com.github.GitHub.GHInstallCLI</string>
- 1404 <key>ProgramArguments</key>
- 1405 <array>
- 1406 <string>/Library/PrivilegedHelperTools/com.github.GitHub.GHInstallCLI</string>
- 1407 </array>
- 1408 </dict>
- 1409 </plist>
- 1410
- 1411 Contents of /Library/LaunchDaemons/com.intego.WashingMachine.service.plist
- 1412 - mod date: Jan 21 08:40:48 2014
- 1413 - size (B): 520
- 1414 - checksum: 3328159078
- 1415
- 1416 <?xml version="1.0" encoding="UTF-8"?>
- 1417 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1418 <plist version="1.0">
- 1419 <dict>
- 1420 <key>Label</key>
- 1421 <string>com.intego.WashingMachine.service</string>
- 1422 <key>KeepAlive</key>
- 1423 <true/>
- 1424 <key>MachServices</key>
- 1425 <dict>
- 1426 <key>com.intego.WashingMachine.service</key>
- 1427 <true/>
- 1428 </dict>
- 1429 <key>ProgramArguments</key>
- 1430 <array>
- 1431 <string>/Library/PrivilegedHelperTools/com.intego.WashingMachine.service</string>
- 1432 </array>
- 1433 </dict>
- 1434 </plist>
- 1435
- 1436 Contents of /Library/LaunchDaemons/com.intego.commonservices.daemon.integod.plist
- 1437 - mod date: Nov 12 09:59:52 2013
- 1438 - size (B): 418
- 1439 - checksum: 3331282155
- 1440
- 1441 <?xml version="1.0" encoding="UTF-8"?>
- 1442 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1443 <plist version="1.0">
- 1444 <dict>
- 1445 <key>Label</key>
- 1446 <string>com.intego.commonservices.daemon.integod</string>
- 1447 <key>RunAtLoad</key>
- 1448 <true/>
- 1449 <key>KeepAlive</key>
- 1450 <true/>
- 1451 <key>ProgramArguments</key>
- 1452 <array>
- 1453 <string>/Library/Intego/integod</string>
- 1454 </array>
- 1455 </dict>
- 1456 </plist>
- 1457
- 1458 Contents of /Library/LaunchDaemons/com.intego.commonservices.daemon.taskmanager.plist
- 1459 - mod date: Nov 12 09:59:52 2013
- 1460 - size (B): 444
- 1461 - checksum: 2890455724
- 1462
- 1463 <?xml version="1.0" encoding="UTF-8"?>
- 1464 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1465 <plist version="1.0">
- 1466 <dict>
- 1467 <key>Label</key>
- 1468 <string>com.intego.commonservices.daemon.taskmanager</string>
- 1469 <key>RunAtLoad</key>
- 1470 <true/>
- 1471 <key>KeepAlive</key>
- 1472 <true/>
- 1473 <key>ProgramArguments</key>
- 1474 <array>
- 1475 <string>/Library/Intego/TaskManager/TaskManagerDaemon</string>
- 1476 </array>
- 1477 </dict>
- 1478 </plist>
- 1479
- 1480 Contents of /Library/LaunchDaemons/com.intego.commonservices.icalserver.plist
- 1481 - mod date: Nov 12 09:59:52 2013
- 1482 - size (B): 635
- 1483 - checksum: 1036205248
- 1484
- 1485 <?xml version="1.0" encoding="UTF-8"?>
- 1486 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1487 <plist version="1.0">
- 1488 <dict>
- 1489 <key>ServiceIPC</key>
- 1490 <true/>
- 1491 <key>Label</key>
- 1492 <string>com.intego.commonservices.icalserver</string>
- 1493 <key>Sockets</key>
- 1494 <dict>
- 1495 <key>Listeners</key>
- 1496 <dict>
- 1497 <key>SockNodeName</key>
- 1498 <string>127.0.0.1</string>
- 1499 <key>SockServiceName</key>
- 1500 <string>47807</string>
- 1501 <key>SockFamily</key>
- 1502 <string>IPv4</string>
- 1503 </dict>
- 1504 </dict>
- 1505 <key>ProgramArguments</key>
- 1506 <array>
- 1507 <string>/Library/Intego/IntegoiCalServer</string>
- 1508 </array>
- 1509 </dict>
- 1510
- 1511 ...and 1 more line(s)
- 1512
- 1513 Contents of /Library/LaunchDaemons/com.intego.commonservices.metrics.kschecker.plist
- 1514 - mod date: Nov 12 10:01:09 2013
- 1515 - size (B): 416
- 1516 - checksum: 500882172
- 1517
- 1518 <?xml version="1.0" encoding="UTF-8"?>
- 1519 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1520 <plist version="1.0">
- 1521 <dict>
- 1522 <key>Label</key>
- 1523 <string>com.intego.commonservices.metrics.kschecker</string>
- 1524 <key>Program</key>
- 1525 <string>/Library/Intego/im_ks_tool</string>
- 1526 <key>RunAtLoad</key>
- 1527 <true/>
- 1528 <key>StartInterval</key>
- 1529 <integer>86400</integer>
- 1530 </dict>
- 1531 </plist>
- 1532
- 1533 Contents of /Library/LaunchDaemons/com.intego.netupdate.daemon.plist
- 1534 - mod date: Jun 29 08:50:18 2015
- 1535 - size (B): 456
- 1536 - checksum: 2886808918
- 1537
- 1538 <?xml version="1.0" encoding="UTF-8"?>
- 1539 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1540 <plist version="1.0">
- 1541 <dict>
- 1542 <key>Label</key>
- 1543 <string>com.intego.netupdate.daemon</string>
- 1544 <key>RunAtLoad</key>
- 1545 <true/>
- 1546 <key>KeepAlive</key>
- 1547 <true/>
- 1548 <key>ProgramArguments</key>
- 1549 <array>
- 1550 <string>/Library/Intego/netupdated.bundle/Contents/Resources/com.intego.netupdated</string>
- 1551 </array>
- 1552 </dict>
- 1553 </plist>
- 1554
- 1555 Contents of /Library/LaunchDaemons/com.intego.virusbarrier.daemon.emlparser.plist
- 1556 - mod date: Sep 6 11:38:57 2013
- 1557 - size (B): 501
- 1558 - checksum: 3875365843
- 1559
- 1560 <?xml version="1.0" encoding="UTF-8"?>
- 1561 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1562 <plist version="1.0">
- 1563 <dict>
- 1564 <key>Label</key>
- 1565 <string>com.intego.virusbarrier.daemon.emlparser</string>
- 1566 <key>ProgramArguments</key>
- 1567 <array>
- 1568 <string>/Library/Intego/virusbarrier.bundle/Contents/MacOS/vbemlparser</string>
- 1569 </array>
- 1570 <key>MachServices</key>
- 1571 <dict>
- 1572 <key>com.intego.virusbarrier.daemon.emlparser</key>
- 1573 <true/>
- 1574 </dict>
- 1575 </dict>
- 1576 </plist>
- 1577
- 1578 Contents of /Library/LaunchDaemons/com.intego.virusbarrier.daemon.logger.plist
- 1579 - mod date: Sep 6 11:38:57 2013
- 1580 - size (B): 497
- 1581 - checksum: 1390371758
- 1582
- 1583 <?xml version="1.0" encoding="UTF-8"?>
- 1584 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1585 <plist version="1.0">
- 1586 <dict>
- 1587 <key>Label</key>
- 1588 <string>com.intego.virusbarrier.daemon.logger</string>
- 1589 <key>ProgramArguments</key>
- 1590 <array>
- 1591 <string>/Library/Intego/virusbarrier.bundle/Contents/MacOS/virusbarrierl</string>
- 1592 </array>
- 1593 <key>MachServices</key>
- 1594 <dict>
- 1595 <key>com.intego.virusbarrier.daemon.logger</key>
- 1596 <true/>
- 1597 </dict>
- 1598 </dict>
- 1599 </plist>
- 1600
- 1601 Contents of /Library/LaunchDaemons/com.intego.virusbarrier.daemon.plist
- 1602 - mod date: Sep 6 11:38:57 2013
- 1603 - size (B): 576
- 1604 - checksum: 2263010952
- 1605
- 1606 <?xml version="1.0" encoding="UTF-8"?>
- 1607 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1608 <plist version="1.0">
- 1609 <dict>
- 1610 <key>Label</key>
- 1611 <string>com.intego.virusbarrier.daemon</string>
- 1612 <key>KeepAlive</key>
- 1613 <true/>
- 1614 <key>ProgramArguments</key>
- 1615 <array>
- 1616 <string>/Library/Intego/virusbarrier.bundle/Contents/MacOS/virusbarrierd</string>
- 1617 </array>
- 1618 <key>MachServices</key>
- 1619 <dict>
- 1620 <key>com.intego.virusbarrier.daemon</key>
- 1621 <true/>
- 1622 <key>com.intego.virusbarrier.daemon.checkin</key>
- 1623 <true/>
- 1624 </dict>
- 1625 </dict>
- 1626 </plist>
- 1627
- 1628 Contents of /Library/LaunchDaemons/com.intego.virusbarrier.daemon.scanner.plist
- 1629 - mod date: Sep 6 11:38:57 2013
- 1630 - size (B): 499
- 1631 - checksum: 3058859818
- 1632
- 1633 <?xml version="1.0" encoding="UTF-8"?>
- 1634 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1635 <plist version="1.0">
- 1636 <dict>
- 1637 <key>Label</key>
- 1638 <string>com.intego.virusbarrier.daemon.scanner</string>
- 1639 <key>ProgramArguments</key>
- 1640 <array>
- 1641 <string>/Library/Intego/virusbarrier.bundle/Contents/MacOS/virusbarriers</string>
- 1642 </array>
- 1643 <key>MachServices</key>
- 1644 <dict>
- 1645 <key>com.intego.virusbarrier.daemon.scanner</key>
- 1646 <true/>
- 1647 </dict>
- 1648 </dict>
- 1649 </plist>
- 1650
- 1651 Contents of /Library/LaunchDaemons/com.iobit.AMCDaemon.plist
- 1652 - mod date: Nov 1 22:15:02 2015
- 1653 - size (B): 485
- 1654 - checksum: 3248374927
- 1655
- 1656 <?xml version="1.0" encoding="UTF-8"?>
- 1657 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1658 <plist version="1.0">
- 1659 <dict>
- 1660 <key>KeepAlive</key>
- 1661 <true/>
- 1662 <key>Label</key>
- 1663 <string>com.iobit.AMCDaemon</string>
- 1664 <key>UserName</key>
- 1665 <string>root</string>
- 1666 <key>ProgramArguments</key>
- 1667 <array>
- 1668 <string>/Library/Application Support/AMC/AMCDaemon</string>
- 1669 <string>-load</string>
- 1670 </array>
- 1671 <key>RunAtLoad</key>
- 1672 <true/>
- 1673 </dict>
- 1674 </plist>
- 1675
- 1676 Contents of /Library/LaunchDaemons/com.maintain.CocktailScheduler.plist
- 1677 - Apple binary property list
- 1678 - mod date: Nov 11 20:06:37 2015
- 1679 - size (B): 547
- 1680 - checksum: 1500495412
- 1681
- 1682 Dict {
- 1683 ProgramArguments = Array {
- 1684 /usr/bin/osascript
- 1685 -e
- 1686 try
- 1687 -e
- 1688 set schedulerOwner to do shell script "defaults read /Library/'Application Support'/Cocktail/Scheduler.plist SchedulerOwner"
- 1689 -e
- 1690 do shell script "users"
- 1691 -e
- 1692 if the result contains schedulerOwner then
- 1693 -e
- 1694 do shell script "/bin/sh /Library/'Application Support'/Cocktail/Scheduler.sh"
- 1695 -e
- 1696 end if
- 1697 -e
- 1698 end try
- 1699 }
- 1700 Disabled = false
- 1701 StartCalendarInterval = Dict {
- 1702 Hour = 3
- 1703 Minute = 0
- 1704 }
- 1705 Label = com.maintain.cocktail.scheduler
- 1706 }
- 1707
- 1708 Contents of /Library/LaunchDaemons/com.maintain.HideSpotlightMenuBarIcon.plist
- 1709 - Apple binary property list
- 1710 - mod date: Jan 19 23:17:46 2015
- 1711 - size (B): 256
- 1712 - checksum: 2176217327
- 1713
- 1714 Dict {
- 1715 ProgramArguments = Array {
- 1716 /bin/chmod
- 1717 600
- 1718 /System/Library/CoreServices/Spotlight.app/Contents/MacOS/Spotlight
- 1719 }
- 1720 StartInterval = 60
- 1721 Disabled = true
- 1722 Label = com.maintain.HideSpotlightMenuBarIcon
- 1723 RunAtLoad = true
- 1724 }
- 1725
- 1726 Contents of /Library/LaunchDaemons/com.malwarebytes.MBAMHelperTool.plist
- 1727 - mod date: Oct 23 20:20:35 2015
- 1728 - size (B): 584
- 1729 - checksum: 2299099766
- 1730
- 1731 <?xml version="1.0" encoding="UTF-8"?>
- 1732 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1733 <plist version="1.0">
- 1734 <dict>
- 1735 <key>Label</key>
- 1736 <string>com.malwarebytes.MBAMHelperTool</string>
- 1737 <key>MachServices</key>
- 1738 <dict>
- 1739 <key>com.malwarebytes.MBAMHelperTool</key>
- 1740 <true/>
- 1741 </dict>
- 1742 <key>Program</key>
- 1743 <string>/Library/PrivilegedHelperTools/com.malwarebytes.MBAMHelperTool</string>
- 1744 <key>ProgramArguments</key>
- 1745 <array>
- 1746 <string>/Library/PrivilegedHelperTools/com.malwarebytes.MBAMHelperTool</string>
- 1747 </array>
- 1748 </dict>
- 1749 </plist>
- 1750
- 1751 Contents of /Library/LaunchDaemons/com.microsoft.autoupdate.helpertool.plist
- 1752 - mod date: Oct 16 14:20:46 2015
- 1753 - size (B): 600
- 1754 - checksum: 3423398678
- 1755
- 1756 <?xml version="1.0" encoding="UTF-8"?>
- 1757 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1758 <plist version="1.0">
- 1759 <dict>
- 1760 <key>Label</key>
- 1761 <string>com.microsoft.autoupdate.helpertool</string>
- 1762 <key>MachServices</key>
- 1763 <dict>
- 1764 <key>com.microsoft.autoupdate.helpertool</key>
- 1765 <true/>
- 1766 </dict>
- 1767 <key>Program</key>
- 1768 <string>/Library/PrivilegedHelperTools/com.microsoft.autoupdate.helpertool</string>
- 1769 <key>ProgramArguments</key>
- 1770 <array>
- 1771 <string>/Library/PrivilegedHelperTools/com.microsoft.autoupdate.helpertool</string>
- 1772 </array>
- 1773 </dict>
- 1774 </plist>
- 1775
- 1776 Contents of /Library/LaunchDaemons/com.microsoft.office.licensingV2.helper.plist
- 1777 - mod date: Aug 7 02:55:38 2015
- 1778 - size (B): 657
- 1779 - checksum: 1698653368
- 1780
- 1781 <?xml version="1.0" encoding="UTF-8"?>
- 1782 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1783 <plist version="1.0">
- 1784 <dict>
- 1785 <key>Label</key>
- 1786 <string>com.microsoft.office.licensingV2.helper</string>
- 1787 <key>MachServices</key>
- 1788 <dict>
- 1789 <key>com.microsoft.office.licensingV2.helper.port</key>
- 1790 <true/>
- 1791 </dict>
- 1792 <key>Program</key>
- 1793 <string>/Library/PrivilegedHelperTools/com.microsoft.office.licensingV2.helper</string>
- 1794 <key>ProgramArguments</key>
- 1795 <array>
- 1796 <string>/Library/PrivilegedHelperTools/com.microsoft.office.licensingV2.helper</string>
- 1797 </array>
- 1798 </dict>
- 1799 </plist>
- 1800
- 1801 Contents of /Library/LaunchDaemons/com.paragon.NTFS.launch.plist
- 1802 - exported SGML document text
- 1803 - mod date: Oct 23 05:55:52 2015
- 1804 - size (B): 641
- 1805 - checksum: 1766326959
- 1806
- 1807 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1808 <plist version="1.0">
- 1809 <dict>
- 1810 <key>KeepAlive</key>
- 1811 <false/>
- 1812 <key>Label</key>
- 1813 <string>com.paragon.NTFS.launch</string>
- 1814 <key>ProgramArguments</key>
- 1815 <array>
- 1816 <string>/sbin/kextload</string>
- 1817 <string>/Library/Extensions/ufsd_NTFS.kext</string>
- 1818 </array>
- 1819 <key>RunAtLoad</key>
- 1820 <true/>
- 1821 <key>StandardErrorPath</key>
- 1822 <string>/dev/null</string>
- 1823 <key>StandardOutPath</key>
- 1824 <string>/dev/null</string>
- 1825 </dict>
- 1826 </plist>
- 1827
- 1828 Contents of /Library/LaunchDaemons/com.robohippo.HippoConnectDaemon.plist
- 1829 - mod date: Jan 7 01:36:47 2014
- 1830 - size (B): 722
- 1831 - checksum: 2324563567
- 1832
- 1833 <?xml version="1.0" encoding="UTF-8"?>
- 1834 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1835 <plist version="1.0">
- 1836 <dict>
- 1837 <key>GroupName</key>
- 1838 <string>wheel</string>
- 1839 <key>KeepAlive</key>
- 1840 <true/>
- 1841 <key>Label</key>
- 1842 <string>com.robohippo.HippoConnectDaemon</string>
- 1843 <key>LimitLoadToSessionType</key>
- 1844 <array>
- 1845 <string>LoginWindow</string>
- 1846 </array>
- 1847 <key>OnDemand</key>
- 1848 <false/>
- 1849 <key>ProgramArguments</key>
- 1850 <array>
- 1851 <string>/Library/Application Support/HippoConnect/HippoConnectAgent</string>
- 1852 <string>-d</string>
- 1853 <string>-p</string>
- 1854 <string>c0nn0r</string>
- 1855 </array>
- 1856 <key>RunAtLoad</key>
- 1857 <true/>
- 1858
- 1859 ...and 4 more line(s)
- 1860
- 1861 Contents of /Library/LaunchDaemons/com.siber.gs-server.plist
- 1862 - mod date: Oct 23 11:32:05 2015
- 1863 - size (B): 441
- 1864 - checksum: 2477576512
- 1865
- 1866 <?xml version="1.0" encoding="UTF-8"?>
- 1867 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1868 <plist version="1.0">
- 1869 <dict>
- 1870 <key>Label</key>
- 1871 <string>gs-server</string>
- 1872 <key>ProgramArguments</key>
- 1873 <array>
- 1874 <string>/Library/Application Support/GoodSync/gs-server</string>
- 1875 </array>
- 1876 <key>RunAtLoad</key>
- 1877 <true/>
- 1878 <key>onDemand</key>
- 1879 <false/>
- 1880 <key>Disable</key>
- 1881 <false/>
- 1882 </dict>
- 1883 </plist>
- 1884
- 1885 Contents of /Library/LaunchDaemons/com.sibersystems.GsRunner-gvantass.plist
- 1886 - mod date: Oct 26 19:31:50 2015
- 1887 - size (B): 470
- 1888 - checksum: 3336912374
- 1889
- 1890 <?xml version="1.0" encoding="UTF-8"?>
- 1891 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1892 <plist version="1.0">
- 1893 <dict>
- 1894 <key>KeepAlive</key>
- 1895 <false/>
- 1896 <key>Label</key>
- 1897 <string>com.sibersystems.GsRunner-gvantass</string>
- 1898 <key>Program</key>
- 1899 <string>/Users/USER/Library/Application Support/GoodSync/GsRunner</string>
- 1900 <key>RunAtLoad</key>
- 1901 <true/>
- 1902 <key>UserName</key>
- 1903 <string>gvantass</string>
- 1904 </dict>
- 1905 </plist>
- 1906
- 1907 Contents of /Library/LaunchDaemons/com.soma-zone.LaunchControl.Helper.plist
- 1908 - mod date: Oct 31 22:46:31 2015
- 1909 - size (B): 596
- 1910 - checksum: 2409053696
- 1911
- 1912 <?xml version="1.0" encoding="UTF-8"?>
- 1913 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1914 <plist version="1.0">
- 1915 <dict>
- 1916 <key>Label</key>
- 1917 <string>com.soma-zone.LaunchControl.Helper</string>
- 1918 <key>MachServices</key>
- 1919 <dict>
- 1920 <key>com.soma-zone.LaunchControl.Helper</key>
- 1921 <true/>
- 1922 </dict>
- 1923 <key>Program</key>
- 1924 <string>/Library/PrivilegedHelperTools/com.soma-zone.LaunchControl.Helper</string>
- 1925 <key>ProgramArguments</key>
- 1926 <array>
- 1927 <string>/Library/PrivilegedHelperTools/com.soma-zone.LaunchControl.Helper</string>
- 1928 </array>
- 1929 </dict>
- 1930 </plist>
- 1931
- 1932 Contents of /Library/LaunchDaemons/com.speedtools.scheduleagent.plist
- 1933 - mod date: Dec 13 21:27:53 2014
- 1934 - size (B): 480
- 1935 - checksum: 2191118651
- 1936
- 1937 <?xml version="1.0" encoding="UTF-8"?>
- <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- <plist version="1.0">
- <dict>
- <key>Label</key>
- <string>com.speedtools.scheduleagent</string>
- <key>Program</key>
- <string>/Library/Application Support/SpeedTools Utilities Support/STU_Helper/STScheduleAgent/STScheduleAgent</string>
- <key>RunAtLoad</key>
- <true/>
- <key>StandardErrorPath</key>
- <string>/dev/null</string>
- </dict>
- </plist>
- 1938
- 1939 Contents of /Library/LaunchDaemons/com.splashtop.streamer-daemon.plist
- 1940 - mod date: Sep 23 04:16:29 2015
- 1941 - size (B): 392
- 1942 - checksum: 2644417781
- 1943
- 1944 <?xml version="1.0" encoding="UTF-8"?>
- 1945 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1946 <plist version="1.0">
- 1947 <dict>
- 1948 <key>Label</key>
- 1949 <string>com.splashtop.streamer-daemon</string>
- 1950 <key>KeepAlive</key>
- 1951 <true/>
- 1952 <key>Program</key>
- 1953 <string>/Applications/Splashtop Streamer.app/Contents/MacOS/SRStreamerDaemon</string>
- 1954 </dict>
- 1955 </plist>
- 1956
- 1957 Contents of /Library/LaunchDaemons/com.splashtop.streamer-srioframebuffer.plist
- 1958 - mod date: Sep 23 04:16:29 2015
- 1959 - size (B): 585
- 1960 - checksum: 358314194
- 1961
- 1962 <?xml version="1.0" encoding="UTF-8"?>
- 1963 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1964 <plist version="1.0">
- 1965 <dict>
- 1966 <key>Label</key>
- 1967 <string>com.splashtop.streamer-srioframebuffer</string>
- 1968 <key>KeepAlive</key>
- 1969 <dict>
- 1970 <key>SuccessfulExit</key>
- 1971 <false/>
- 1972 <key>AfterInitialDemand</key>
- 1973 <false/>
- 1974 </dict>
- 1975 <key>RunAtLoad</key>
- 1976 <true/>
- 1977 <key>ProgramArguments</key>
- 1978 <array>
- 1979 <string>/Applications/Splashtop Streamer.app/Contents/MacOS/SRIOFrameBuffer.app/Contents/MacOS/SRIOFrameBuffer</string>
- 1980 </array>
- 1981 </dict>
- 1982 </plist>
- 1983
- 1984 Contents of /Library/LaunchDaemons/com.surteesstudios.Bartender.BartenderInstallHelper.plist
- 1985 - mod date: Oct 9 01:23:37 2015
- 1986 - size (B): 664
- 1987 - checksum: 534097078
- 1988
- 1989 <?xml version="1.0" encoding="UTF-8"?>
- 1990 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 1991 <plist version="1.0">
- 1992 <dict>
- 1993 <key>Label</key>
- 1994 <string>com.surteesstudios.Bartender.BartenderInstallHelper</string>
- 1995 <key>MachServices</key>
- 1996 <dict>
- 1997 <key>com.surteesstudios.Bartender.BartenderInstallHelper</key>
- 1998 <true/>
- 1999 </dict>
- 2000 <key>Program</key>
- 2001 <string>/Library/PrivilegedHelperTools/com.surteesstudios.Bartender.BartenderInstallHelper</string>
- 2002 <key>ProgramArguments</key>
- 2003 <array>
- 2004 <string>/Library/PrivilegedHelperTools/com.surteesstudios.Bartender.BartenderInstallHelper</string>
- 2005 </array>
- 2006 </dict>
- 2007 </plist>
- 2008
- 2009 Contents of /Library/LaunchDaemons/com.tunabellysoftware.TGFanHelper.plist
- 2010 - mod date: Sep 30 21:38:06 2015
- 2011 - size (B): 592
- 2012 - checksum: 3565692930
- 2013
- 2014 <?xml version="1.0" encoding="UTF-8"?>
- 2015 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2016 <plist version="1.0">
- 2017 <dict>
- 2018 <key>Label</key>
- 2019 <string>com.tunabellysoftware.TGFanHelper</string>
- 2020 <key>MachServices</key>
- 2021 <dict>
- 2022 <key>com.tunabellysoftware.TGFanHelper</key>
- 2023 <true/>
- 2024 </dict>
- 2025 <key>Program</key>
- 2026 <string>/Library/PrivilegedHelperTools/com.tunabellysoftware.TGFanHelper</string>
- 2027 <key>ProgramArguments</key>
- 2028 <array>
- 2029 <string>/Library/PrivilegedHelperTools/com.tunabellysoftware.TGFanHelper</string>
- 2030 </array>
- 2031 </dict>
- 2032 </plist>
- 2033
- 2034 Contents of /Library/LaunchDaemons/comp.text.tex.distribution.Helper.plist
- 2035 - mod date: Oct 1 21:24:16 2015
- 2036 - size (B): 677
- 2037 - checksum: 778879715
- 2038
- 2039 <?xml version="1.0" encoding="UTF-8"?>
- 2040 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2041 <plist version="1.0">
- 2042 <dict>
- 2043 <key>Label</key>
- 2044 <string>comp.text.tex.distribution.Helper</string>
- 2045 <key>MachServices</key>
- 2046 <dict>
- 2047 <key>comp.text.tex.distribution.Helper</key>
- 2048 <true/>
- 2049 </dict>
- 2050 <key>ProgramArguments</key>
- 2051 <array>
- 2052 <string>/Library/PreferencePanes/TeXDistPrefPane.prefPane/Contents/Library/LaunchServices/comp.text.tex.distribution.Helper</string>
- 2053 <string>--launch-service</string>
- 2054 <string>--version</string>
- 2055 <string>271</string>
- 2056 <string>--pid</string>
- 2057 <string>1843</string>
- 2058 </array>
- 2059 </dict>
- 2060 </plist>
- 2061
- 2062 Contents of /Library/LaunchDaemons/org.cindori.CCAuth.plist
- 2063 - mod date: Feb 7 19:56:37 2015
- 2064 - size (B): 532
- 2065 - checksum: 2771150299
- 2066
- 2067 <?xml version="1.0" encoding="UTF-8"?>
- 2068 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2069 <plist version="1.0">
- 2070 <dict>
- 2071 <key>Label</key>
- 2072 <string>org.cindori.CCAuth</string>
- 2073 <key>MachServices</key>
- 2074 <dict>
- 2075 <key>org.cindori.CCAuth</key>
- 2076 <true/>
- 2077 </dict>
- 2078 <key>Program</key>
- 2079 <string>/Library/PrivilegedHelperTools/org.cindori.CCAuth</string>
- 2080 <key>ProgramArguments</key>
- 2081 <array>
- 2082 <string>/Library/PrivilegedHelperTools/org.cindori.CCAuth</string>
- 2083 </array>
- 2084 </dict>
- 2085 </plist>
- 2086
- 2087 Contents of /Library/LaunchDaemons/org.gpgtools.gpgmail.patch-uuid.plist
- 2088 - mod date: Mar 8 08:03:00 2015
- 2089 - size (B): 410
- 2090 - checksum: 4206690072
- 2091
- 2092 <?xml version="1.0" encoding="UTF-8"?>
- 2093 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2094 <plist version="1.0">
- 2095 <dict>
- 2096 <key>Label</key>
- 2097 <string>org.gpgtools.gpgmail.uuid-patcher</string>
- 2098 <key>Program</key>
- 2099 <string>/Library/Application Support/GPGTools/uuid-patcher</string>
- 2100 <key>RunAtLoad</key>
- 2101 <true/>
- 2102 <key>KeepAlive</key>
- 2103 <false/>
- 2104 </dict>
- 2105 </plist>
- 2106
- 2107 Contents of /System/Library/LaunchAgents/net.culater.SIMBL.Agent.plist
- 2108 - mod date: Oct 24 21:21:27 2015
- 2109 - size (B): 515
- 2110 - checksum: 1016867470
- 2111
- 2112 <?xml version="1.0" encoding="UTF-8"?>
- 2113 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2114 <plist version="1.0">
- 2115 <dict>
- 2116 <key>Label</key>
- 2117 <string>net.culater.SIMBL.Agent</string>
- 2118 <key>Program</key>
- 2119 <string>/System/Library/ScriptingAdditions/SIMBL.osax/Contents/Resources/SIMBL Agent.app/Contents/MacOS/SIMBL Agent</string>
- 2120 <key>RunAtLoad</key>
- 2121 <false/>
- 2122 <key>LimitLoadToSessionType</key>
- 2123 <string>Aqua</string>
- 2124 <key>OnDemand</key>
- 2125 <false/>
- 2126 </dict>
- 2127 </plist>
- 2128
- 2129 Contents of /private/etc/hosts
- 2130 - mod date: Sep 22 19:45:41 2015
- 2131 - size (B): 236
- 2132 - checksum: 85078130
- 2133
- 2134 127.0.0.1 localhost
- 2135 255.255.255.255 broadcasthost
- 2136 ::1 localhost
- 2137 fe80::1%lo0 localhost
- 2138
- 2139 Contents of Library/LaunchAgents/com.adobe.ARM.UUID.plist
- 2140 - mod date: Mar 12 13:21:49 2015
- 2141 - size (B): 603
- 2142 - checksum: 394026997
- 2143
- 2144 <?xml version="1.0" encoding="UTF-8"?>
- 2145 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2146 <plist version="1.0">
- 2147 <dict>
- 2148 <key>Label</key>
- 2149 <string>com.adobe.ARM.UUID</string>
- 2150 <key>ProgramArguments</key>
- 2151 <array>
- 2152 <string>/Applications/Adobe Reader.app/Contents/MacOS/Updater/Adobe Reader Updater Helper.app/Contents/MacOS/Adobe Reader Updater Helper</string>
- 2153 <string>semi-auto</string>
- 2154 </array>
- 2155 <key>RunAtLoad</key>
- 2156 <true/>
- 2157 <key>StartInterval</key>
- 2158 <integer>12600</integer>
- 2159 </dict>
- 2160 </plist>
- 2161
- 2162 Contents of Library/LaunchAgents/com.amazon.music.plist
- 2163 - mod date: Sep 27 15:04:21 2015
- 2164 - size (B): 448
- 2165 - checksum: 3668832669
- 2166
- 2167 <?xml version="1.0" encoding="UTF-8"?>
- 2168 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2169 <plist version="1.0">
- 2170 <dict>
- 2171 <key>EnableTransactions</key>
- 2172 <false/>
- 2173 <key>KeepAlive</key>
- 2174 <true/>
- 2175 <key>Label</key>
- 2176 <string>com.amazon.music</string>
- 2177 <key>Program</key>
- 2178 <string>/Applications/Amazon Music.app/Contents/MacOS/Amazon Music Helper</string>
- 2179 <key>RunAtLoad</key>
- 2180 <true/>
- 2181 </dict>
- 2182 </plist>
- 2183
- 2184 Contents of Library/LaunchAgents/com.couchpotato.movies.plist
- 2185 - mod date: Aug 28 17:07:45 2015
- 2186 - size (B): 618
- 2187 - checksum: 2650482328
- 2188
- 2189 <?xml version="1.0" encoding="UTF-8"?>
- 2190 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2191 <plist version="1.0">
- 2192 <dict>
- 2193 <key>Label</key>
- 2194 <string>com.couchpotato.movies</string>
- 2195 <key>ProgramArguments</key>
- 2196 <array>
- 2197 <string>/usr/local/bin/python</string>
- 2198 <string>/Applications/CouchPotatoServer/CouchPotato.py</string>
- 2199 <string>--quiet</string>
- 2200 </array>
- 2201 <key>RunAtLoad</key>
- 2202 <true/>
- 2203 <key>StandardErrorPath</key>
- 2204 <string>/tmp/com.couchpotato.movies.err</string>
- 2205 <key>StandardOutPath</key>
- 2206 <string>/tmp/com.couchpotato.movies.out</string>
- 2207 </dict>
- 2208 </plist>
- 2209
- 2210 Contents of Library/LaunchAgents/com.ecamm.printopia.plist
- 2211 - mod date: Sep 19 05:26:20 2015
- 2212 - size (B): 457
- 2213 - checksum: 1467394531
- 2214
- 2215 <?xml version="1.0" encoding="UTF-8"?>
- 2216 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2217 <plist version="1.0">
- 2218 <dict>
- 2219 <key>Label</key>
- 2220 <string>com.ecamm.printopia</string>
- 2221 <key>Program</key>
- 2222 <string>/Users/USER/Library/PreferencePanes/Printopia.prefPane/Contents/MacOS/Printopia Server.app/Contents/MacOS/Printopia Server</string>
- 2223 <key>StartInterval</key>
- 2224 <integer>3</integer>
- 2225 </dict>
- 2226 </plist>
- 2227
- 2228 Contents of Library/LaunchAgents/com.erikhinterbichler.HeraldLaunchAgent.plist
- 2229 - mod date: Oct 23 04:24:03 2015
- 2230 - size (B): 543
- 2231 - checksum: 1144872817
- 2232
- 2233 <?xml version="1.0" encoding="UTF-8"?>
- 2234 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2235 <plist version="1.0">
- 2236 <dict>
- 2237 <key>KeepAlive</key>
- 2238 <true/>
- 2239 <key>Label</key>
- 2240 <string>com.erikhinterbichler.HeraldLaunchAgent</string>
- 2241 <key>LimitLoadToSessionType</key>
- 2242 <string>Aqua</string>
- 2243 <key>ProgramArguments</key>
- 2244 <array>
- 2245 <string>/Users/USER/Library/Mail/Bundles/Herald.mailbundle/Contents/Resources/HeraldLaunchAgent</string>
- 2246 </array>
- 2247 <key>RunAtLoad</key>
- 2248 <true/>
- 2249 </dict>
- 2250 </plist>
- 2251
- 2252 Contents of Library/LaunchAgents/com.iobit.MacBoosterMini.plist
- 2253 - mod date: Nov 9 22:22:26 2015
- 2254 - size (B): 473
- 2255 - checksum: 500596684
- 2256
- 2257 <?xml version="1.0" encoding="UTF-8"?>
- 2258 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2259 <plist version="1.0">
- 2260 <dict>
- 2261 <key>KeepAlive</key>
- 2262 <true/>
- 2263 <key>Label</key>
- 2264 <string>com.iobit.MacBooster-mini</string>
- 2265 <key>Program</key>
- 2266 <string>/Users/USER/Library/Application Support/MacBooster 3/MacBooster mini.app/Contents/MacOS/MacBooster mini</string>
- 2267 <key>Version</key>
- 2268 <integer>14053</integer>
- 2269 </dict>
- 2270 </plist>
- 2271
- 2272 Contents of Library/LaunchAgents/com.iobit.iosMonitor.plist
- 2273 - mod date: Jan 4 23:28:38 2015
- 2274 - size (B): 540
- 2275 - checksum: 1735592826
- 2276
- 2277 <?xml version="1.0" encoding="UTF-8"?>
- 2278 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2279 <plist version="1.0">
- 2280 <dict>
- 2281 <key>KeepAlive</key>
- 2282 <true/>
- 2283 <key>Label</key>
- 2284 <string>com.iobit.iosMonitor</string>
- 2285 <key>MainApp</key>
- 2286 <string>/Applications/iFreeUp.app/Contents/MacOS/iFreeUp</string>
- 2287 <key>Program</key>
- 2288 <string>/Users/USER/Library/Application Support/iFreeup/iosMonitor.app/Contents/MacOS/iosMonitor</string>
- 2289 <key>Version</key>
- 2290 <integer>11609</integer>
- 2291 </dict>
- 2292 </plist>
- 2293
- 2294 Contents of Library/LaunchAgents/com.littleknownsoftware.MailPluginTool-Startup.plist
- 2295 - mod date: Jul 22 03:06:47 2015
- 2296 - size (B): 598
- 2297 - checksum: 3693610461
- 2298
- 2299 <?xml version="1.0" encoding="UTF-8"?>
- 2300 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2301 <plist version="1.0">
- 2302 <dict>
- 2303 <key>KeepAlive</key>
- 2304 <false/>
- 2305 <key>Label</key>
- 2306 <string>com.littleknownsoftware.MailPluginTool-Startup</string>
- 2307 <key>LimitLoadToSessionType</key>
- 2308 <string>Aqua</string>
- 2309 <key>ProgramArguments</key>
- 2310 <array>
- 2311 <string>/Applications/Mail Plugin Manager.app/Contents/Resources/MailPluginTool.app/Contents/MacOS/MailPluginTool</string>
- 2312 <string>-validate-all</string>
- 2313 </array>
- 2314 <key>RunAtLoad</key>
- 2315 <true/>
- 2316 </dict>
- 2317 </plist>
- 2318
- 2319 Contents of Library/LaunchAgents/com.littleknownsoftware.MailPluginTool-Watcher.plist
- 2320 - mod date: Nov 14 01:43:18 2015
- 2321 - size (B): 664
- 2322 - checksum: 4288715610
- 2323
- 2324 <?xml version="1.0" encoding="UTF-8"?>
- 2325 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2326 <plist version="1.0">
- 2327 <dict>
- 2328 <key>KeepAlive</key>
- 2329 <false/>
- 2330 <key>Label</key>
- 2331 <string>com.littleknownsoftware.MailPluginTool-Watcher</string>
- 2332 <key>LimitLoadToSessionType</key>
- 2333 <string>Aqua</string>
- 2334 <key>ProgramArguments</key>
- 2335 <array>
- 2336 <string>/Applications/Mail Plugin Manager.app/Contents/Resources/MailPluginTool.app/Contents/MacOS/MailPluginTool</string>
- 2337 <string>-file-load</string>
- 2338 </array>
- 2339 <key>QueueDirectories</key>
- 2340 <array>
- 2341 <string>/Users/USER/Library/Mail/MPT</string>
- 2342 </array>
- 2343 </dict>
- 2344 </plist>
- 2345
- 2346 Contents of Library/LaunchAgents/com.maintain.ShowUserLibraryDirectory.plist
- 2347 - Apple binary property list
- 2348 - mod date: Nov 11 20:04:36 2015
- 2349 - size (B): 206
- 2350 - checksum: 4070925063
- 2351
- 2352 Dict {
- 2353 ProgramArguments = Array {
- 2354 /usr/bin/chflags
- 2355 nohidden
- 2356 /Users/USER/Library/
- 2357 }
- 2358 RunAtLoad = true
- 2359 Disabled = false
- 2360 Label = com.maintain.ShowUserLibraryDirectory
- 2361 }
- 2362
- 2363 Contents of Library/LaunchAgents/com.rembo10.headphones.plist
- 2364 - mod date: Oct 26 05:30:26 2015
- 2365 - size (B): 643
- 2366 - checksum: 3167464890
- 2367
- 2368 <?xml version="1.0" encoding="UTF-8"?>
- 2369 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2370 <plist version="1.0">
- 2371 <dict>
- 2372 <key>Disabled</key>
- 2373 <true/>
- 2374 <key>Label</key>
- 2375 <string>com.rembo10.headphones</string>
- 2376 <key>ProgramArguments</key>
- 2377 <array>
- 2378 <string>/usr/bin/python</string>
- 2379 <string>/Applications/Headphones/Headphones.py</string>
- 2380 <string>--nolaunch</string>
- 2381 </array>
- 2382 <key>RunAtLoad</key>
- 2383 <true/>
- 2384 <key>StandardErrorPath</key>
- 2385 <string>/tmp/com.rembo10.headphones.stderr</string>
- 2386 <key>StandardOutPath</key>
- 2387 <string>/tmp/com.rembo10.headphones.stdout</string>
- 2388 </dict>
- 2389 </plist>
- 2390
- 2391 Contents of Library/LaunchAgents/com.sickbeard.tv.plist
- 2392 - mod date: Jan 29 02:42:58 2015
- 2393 - size (B): 623
- 2394 - checksum: 2332424744
- 2395
- 2396 <?xml version="1.0" encoding="UTF-8"?>
- 2397 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2398 <plist version="1.0">
- 2399 <dict>
- 2400 <key>Disabled</key>
- 2401 <false/>
- 2402 <key>Label</key>
- 2403 <string>com.sickbeard.tv</string>
- 2404 <key>ProgramArguments</key>
- 2405 <array>
- 2406 <string>/usr/bin/python</string>
- 2407 <string>/Applications/Sick-Beard-development/SickBeard.py</string>
- 2408 <string>-q</string>
- 2409 </array>
- 2410 <key>RunAtLoad</key>
- 2411 <true/>
- 2412 <key>StandardErrorPath</key>
- 2413 <string>/tmp/com.sickbeard.tv.err</string>
- 2414 <key>StandardOutPath</key>
- 2415 <string>/tmp/com.sickbeard.tv.out</string>
- 2416 </dict>
- 2417 </plist>
- 2418
- 2419 Contents of Library/LaunchAgents/com.splashtop.streamer-for-user.plist
- 2420 - mod date: Nov 14 01:33:29 2015
- 2421 - size (B): 653
- 2422 - checksum: 444089276
- 2423
- 2424 <?xml version="1.0" encoding="UTF-8"?>
- 2425 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2426 <plist version="1.0">
- 2427 <dict>
- 2428 <key>KeepAlive</key>
- 2429 <dict>
- 2430 <key>AfterInitialDemand</key>
- 2431 <true/>
- 2432 <key>SuccessfulExit</key>
- 2433 <false/>
- 2434 </dict>
- 2435 <key>Label</key>
- 2436 <string>com.splashtop.streamer-for-user</string>
- 2437 <key>LimitLoadToSessionType</key>
- 2438 <array>
- 2439 <string>Aqua</string>
- 2440 </array>
- 2441 <key>ProgramArguments</key>
- 2442 <array>
- 2443 <string>/Applications/Splashtop Streamer.app/Contents/MacOS/Splashtop Streamer</string>
- 2444 <string>RunAtLogin</string>
- 2445 </array>
- 2446 <key>RunAtLoad</key>
- 2447 <true/>
- 2448 </dict>
- 2449
- 2450 ...and 1 more line(s)
- 2451
- 2452 Contents of Library/LaunchAgents/com.spotify.webhelper.plist
- 2453 - mod date: Aug 6 22:32:43 2015
- 2454 - size (B): 535
- 2455 - checksum: 4220650840
- 2456
- 2457 <?xml version="1.0" encoding="UTF-8"?>
- 2458 <!DOCTYPE plist PUBLIC "-//Apple Computer//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2459 <plist version="1.0">
- 2460 <dict>
- 2461 <key>Label</key>
- 2462 <string>com.spotify.webhelper</string>
- 2463 <key>KeepAlive</key>
- 2464 <dict>
- 2465 <key>NetworkState</key>
- 2466 <true/>
- 2467 </dict>
- 2468 <key>RunAtLoad</key>
- 2469 <true/>
- 2470 <key>Program</key>
- 2471 <string>/Users/USER/Library/Application Support/Spotify/SpotifyWebHelper</string>
- 2472 <key>SpotifyPath</key>
- 2473 <string>/Applications/Spotify.app</string></dict>
- 2474 </plist>
- 2475
- 2476 Contents of Library/LaunchAgents/com.valvesoftware.steamclean.plist
- 2477 - mod date: Mar 11 22:32:44 2015
- 2478 - size (B): 830
- 2479 - checksum: 3009856838
- 2480
- 2481 <?xml version="1.0" encoding="UTF-8"?>
- 2482 <!DOCTYPE plist PUBLIC "-//Apple//DTD PLIST 1.0//EN" "http://www.apple.com/DTDs/PropertyList-1.0.dtd">
- 2483 <plist version="1.0">
- 2484 <dict>
- 2485 <key>Label</key>
- 2486 <string>com.valvesoftware.steamclean</string>
- 2487 <key>Program</key>
- 2488 <string>/Users/USER/Library/Application Support/Steam/SteamApps/steamclean</string>
- 2489 <key>ProgramArguments</key>
- 2490 <array>
- 2491 <string>/Users/USER/Library/Application Support/Steam/SteamApps/steamclean/disable</string>
- 2492 <string>Public</string>
- 2493 </array>
- 2494 <key>RunAtLoad</key>
- 2495 <true/>
- 2496 <key>SteamContentPaths</key>
- 2497 <array>
- 2498 <string>/Users/USER/Library/Application Support/Steam/SteamApps</string>
- 2499 </array>
- 2500 <key>ThrottleInterval</key>
- 2501 <integer>60</integer>
- 2502 <key>WatchPaths</key>
- 2503 <array>
- 2504 <string>/Applications/Steam.app</string>
- 2505 </array>
- 2506
- 2507 ...and 2 more line(s)
- 2508
- 2509 User login items
- 2510
- 2511 Bartender 2
- 2512 - /Applications/Bartender 2.app
- 2513 iTunesHelper
- 2514 - /Applications/iTunes.app/Contents/MacOS/iTunesHelper.app
- 2515 SABnzbd
- 2516 - /Applications/SABnzbd.app
- 2517 WePrint Server
- 2518 - /Applications/WePrint Server.app
- 2519 WDDriveUtilityHelper
- 2520 - /Applications/WD Drive Utilities.app/Contents/WDDriveUtilityHelper.app
- 2521 SaneDesk
- 2522 - /Applications/SaneDesk.app
- 2523 witchdaemon
- 2524 - /Library/PreferencePanes/Witch.prefPane/Contents/Helpers/witchdaemon.app
- 2525 Butler
- 2526 - /Applications/Butler.app
- 2527 VLCStreamer
- 2528 - /Applications/VLCStreamer.app
- 2529 iBetterCharge
- 2530 - /Applications/iBetterCharge.app
- 2531 Boom 2
- 2532 - /Applications/Boom 2.app
- 2533 Dropbox
- 2534 - /Applications/Dropbox.app
- 2535 Todoist
- 2536 - /Applications/Todoist.app
- 2537 Music Manager
- 2538 - /Users/USER/Library/PreferencePanes/MusicManager.prefPane/Contents/Helpers/MusicManagerHelper.app
- 2539 MagicMenu
- 2540 - /Applications/StuffIt Archive Manager.app/Contents/MacOS/MagicMenu.app
- 2541 GoodSync
- 2542 - /Applications/GoodSync.app
- 2543 Screens Connect
- 2544 - /Library/PreferencePanes/Screens Connect.prefPane/Contents/MacOS/Screens Connect.app
- 2545 Amphetamine
- 2546 - /Applications/Amphetamine.app
- 2547 LaunchBar
- 2548 - /Applications/LaunchBar.app
- 2549 cDock-Agent
- 2550 - /Applications/cDock.app/Contents/Resources/cDock-Agent.app
- 2551 Typinator
- 2552 - /Applications/Typinator.app
- 2553 HazelHelper
- 2554 - /Library/PreferencePanes/Hazel.prefPane/Contents/MacOS/HazelHelper.app
- 2555 Plex Media Server
- 2556 - /Applications/Plex Media Server.app
- 2557 Command-C
- 2558 - /Applications/Command-C.app
- 2559 GhostNote
- 2560 - /Applications/GhostNote.app
- 2561 Hocus Focus
- 2562 - /Applications/Hocus Focus.app
- 2563
- 2564 User crontab
- 2565
- 2566 MAILTO=""
- 2567
- 2568 Safari extensions
- 2569
- 2570 1Password
- 2571 - com.agilebits.onepassword4-safari
- 2572 Adblock Plus
- 2573 - org.adblockplus.adblockplussafari
- 2574 Add To Amazon Wish List
- 2575 - com.amazon.safari.wishlist
- 2576 Boomerang for Gmail
- 2577 - com.Baydin.b4gsafari
- 2578 Clip to DEVONthink
- 2579 - com.devon-technologies.think.clip
- 2580 comicSansBeGone
- 2581 - com.sitharus.comicsansbegone
- 2582 CouchPotato
- 2583 - couchpotato.extension
- 2584 Dragon
- 2585 - com.nuance.safari.dgnria
- 2586 Facebook Cleaner
- 2587 - com.sonstermedia.facebookclean
- 2588 Folx
- 2589 - com.eltima.Folx3extension
- 2590 Google Analytics Opt-out Browser Add-on
- 2591 - com.google.AnalyticsOptOutSafariExtension.en
- 2592 Grammarly Spell Checker & Grammar Checker
- 2593 - com.safari.grammarlyspellcheckergrammarcheckerUUID
- 2594 InvisibleHand
- 2595 - com.forward.invisiblehand
- 2596 Make It Short
- 2597 - com.junecloud.makeitshort
- 2598 musicbox
- 2599 - com.tastyapps.musicbox.safariextz
- 2600 Pins Extension
- 2601 - com.objectivesheep.pinsextension
- 2602 PriceBlink
- 2603 - com.priceblink
- 2604 Print Plus
- 2605 - com.slicefactory.printplus
- 2606 Pushbullet
- 2607 - it.fancypixel.pushbullet
- 2608 Save to Pocket
- 2609 - com.ideashower.pocket.safari
- 2610 Social Fixer
- 2611 - com.socialfixer
- 2612 Ultimate Status Bar
- 2613 - com.interclue.ultimatestatusbar
- 2614 UTM Stripper
- 2615 - com.dosburros.safari-utm-stripper
- 2616 Videobox
- 2617 - com.tastyapps.videobox.safariextz
- 2618 Web Snapper
- 2619 - com.tastyapps.websnapper.safariextz
- 2620 WOT
- 2621 - com.wotservicesoy.wot
- 2622
- 2623 Firefox extensions
- 2624
- 2625 Snagit Autoscroll Helper
- 2626 nzbdStatus
- 2627 Universal Print
- 2628 United States English Spellchecker
- 2629 Ĉapelisto
- 2630 Amazon Add to Wish List Button
- 2631 Click&Clean
- 2632 BetterPrivacy
- 2633 Lightbeam for Firefox
- 2634 Esperanto Language Pack
- 2635 Esperanta Vortaro
- 2636 Markdown Here
- 2637 Folx
- 2638 The Amazon 1Button App for Firefox
- 2639 CouchPotato
- 2640 Clip to DEVONthink
- 2641 Disconnect Search
- 2642 Pins
- 2643 Todoist
- 2644 Print Edit
- 2645 Disconnect
- 2646 Adblock Plus
- 2647 traduku
- 2648
- 2649 Prefetching: Off
- 2650
- 2651 Widgets
- 2652
- 2653 Prowler
- 2654
- 2655 iCloud errors
- 2656
- 2657 bird 99
- 2658 backupd 28
- 2659 cloudd 27
- 2660 Safari 19
- 2661 Command-C 8
- 2662 CallHistorySyncHelper 8
- 2663 Deliveries 5
- 2664 cloudphotosd 4
- 2665 Finder 4
- 2666 comapple.InputMethodKit.TextReplacementService 3
- 2667 accountsd 3
- 2668 comapple.ncplugin.weather 2
- 2669 DeliveriesToday 2
- 2670 comapple.appkit.xpc.openAndSavePanelService 1
- 2671 TextEdit 1
- 2672 Airmail 2 1
- 2673
- 2674 Continuity errors
- 2675
- 2676 sharedfilelistd 89
- 2677 sharingd 8
- 2678
- 2679 User caches/logs
- 2680
- 2681 3.8 GiB: Library/Containers/com.apple.iBooksX/Data/Library/Caches/com.apple.iBooksX/ic-BKLibraryImageSource-2.cache
- 2682
- 2683 Restricted files: 567
- 2684
- 2685 Lockfiles: 2
- 2686
- 2687 Global prefs (user)
- 2688
- 2689 "UUID" = <70646674 6f6f6c6b 70646674 6f6f6c69 70646674 6f6f6c74 03000000 745a5546 65426679 46434a4d 74476d67 48464b58 00000000 00000000 00000000 00000000 00000000>
- 2690 AppleEdgeResizeExteriorSize = 10
- 2691 AppleTextBreakLocale = "en_US_POSIX"
- 2692 CGInsertionPtAnimation = 1442657408
- 2693 NSAppSleepDisabled = 1
- 2694 NSCloseAlwaysConfirmsChanges = 1
- 2695 NSFullScreenDarkMenu = 1
- 2696 NSQuitAlwaysKeepsWindows = 1
- 2697 NSRecentDocumentsLimit = 10
- 2698 NSSavePanelStandardDesktopShortcutOnly = 1
- 2699 QLEnableTextSelection = 1
- 2700 WebAutomaticDashSubstitutionEnabled = 1
- 2701 "com.maintain.cocktail" = UUID
- 2702
- 2703 Data packages
- 2704
- 2705 /Users/USER/Library/Mail/Bundles/Face2Face.mailbundle
- 2706 /Users/USER/Library/Mail/Bundles/CargoLifter.mailbundle
- 2707 /Users/USER/Library/Mail/Bundles (Disabled 9)/SendLater.mailbundle
- 2708 /Users/USER/Library/Mail/Bundles (Disabled 9)/Face2Face.mailbundle
- 2709 /Users/USER/Library/Mail/Bundles (Disabled 9)/Graffiti.mailbundle
- 2710 /Users/USER/Library/Mail/Bundles (Disabled 9)/CargoLifter.mailbundle
- 2711 /Users/USER/Library/Mail/Bundles (Disabled 3)/SendLater.mailbundle
- 2712 /Users/USER/Library/Mail/Bundles (Disabled 12)/EverMail.mailbundle
- 2713 /Users/USER/Library/Mail/Bundles (Disabled 12)/Graffiti.mailbundle
- 2714 /Users/USER/Library/Mail/Bundles (Disabled 12)/SendLater.mailbundle
- 2715 /Users/USER/Library/Mail/Bundles (Disabled 3)/CargoLifter.mailbundle
- 2716 /Users/USER/Library/Mail/Bundles (Disabled 2)/Graffiti.mailbundle
- 2717 /Users/USER/Library/Mail/Bundles (Disabled 2)/Face2Face.mailbundle
- 2718 /Users/USER/Library/Mail/Bundles (Disabled 1)/Face2Face.mailbundle
- 2719 /Users/USER/Library/Application Support/SendLater/SendLater 1562/SendLater.mailbundle
- 2720 /Users/USER/Library/Application Support/iWeb/Domain.sites2
- 2721 /Users/USER/Library/Application Support/Face2Face/Face2Face 1231/Face2Face.mailbundle
- 2722 /Users/USER/Library/Application Support/CargoLifter/CargoLifter 2025/CargoLifter.mailbundle
- 2723 /Users/USER/Library/Application Support/CargoLifter/CargoLifter 2024/CargoLifter.mailbundle
- 2724
- 2725 Extensions
- 2726
- 2727 /Library/Extensions/Boom2Device.kext
- 2728 - com.globaldelight.driver.Boom2Device
- 2729 /Library/Extensions/LittleSnitch.kext
- 2730 - at.obdev.nke.LittleSnitch
- 2731 /Library/Extensions/TACC.kext
- 2732 - com.techsmith.TACC
- 2733 /Library/Extensions/klif.kext
- 2734 - com.kaspersky.kext.klif
- 2735 /Library/Extensions/klnke.kext
- 2736 - com.kaspersky.nke
- 2737 /Library/Extensions/tap.kext
- 2738 - foo.tap
- 2739 /Library/Extensions/tun.kext
- 2740 - foo.tun
- 2741 /Library/Extensions/ufsd_NTFS.kext
- 2742 - com.paragon-software.filesystems.ntfs
- 2743 /System/Library/Extensions/AmbrosiaAudioSupport.kext
- 2744 - com.AmbrosiaSW.AudioSupport
- 2745 /System/Library/Extensions/ElmediaPlayer.kext
- 2746 - com.eltima.ElmediaPlayer.kext
- 2747 /System/Library/Extensions/JMicronATA.kext
- 2748 - com.jmicron.JMicronATA
- 2749 /System/Library/Extensions/NoZAP-PL2303-10.9.kext
- 2750 - NoZAP.Driver-PL2303
- 2751 /System/Library/Extensions/ProlificUsbSerial.kext
- 2752 - com.prolific.driver.PL2303
- 2753 /System/Library/Extensions/SRXDisplayCard.kext
- 2754 - com.splashtop.driver.SRXDisplayCard
- 2755 /System/Library/Extensions/SRXFrameBufferConnector.kext
- 2756 - com.splashtop.driver.SRXFrameBufferConnector
- 2757 /System/Library/Extensions/Soundflower.kext
- 2758 - com.Cycling74.driver.Soundflower
- 2759 /System/Library/Extensions/WD1394_64_109HPDriver.kext
- 2760 - com.wdc.driver.1394.64.10.9
- 2761 /System/Library/Extensions/WDUSB_64_109HPDriver.kext
- 2762 - com.wdc.driver.USB.64.10.9
- 2763 /System/Library/Extensions/hp_Inkjet3_io_enabler.kext
- 2764 - com.hp.print.hpio.Inkjet3.kext
- 2765 /System/Library/Extensions/hp_fax_io.kext
- 2766 - com.hp.kext.hp-fax-io
- 2767 /System/Library/Extensions/klif.kext
- 2768 - com.kaspersky.kext.klif
- 2769 /System/Library/Extensions/klnke.kext
- 2770 - com.kaspersky.nke
- 2771 /System/Library/Extensions/osx-pl2303.kext
- 2772 - nl.bjaelectronics.driver.PL2303
- 2773
- 2774 Applications
- 2775
- 2776 /Applications/Aegisub.app
- 2777 - com.aegisub.aegisub
- 2778 /Applications/Braid.app
- 2779 - N/A
- 2780 /Applications/Candy Apple.app
- 2781 - com.128bittech.CandyApple
- 2782 /Applications/Cisdem PDFToolkit.app
- 2783 - com.cisdem.pdftoolkit
- 2784 /Applications/CouchPotato.app
- 2785 - org.pythonmac.unspecified.CouchPotato
- 2786 /Applications/CrossOver.app
- 2787 - N/A
- 2788 /Applications/Deeper.app
- 2789 - com.titanium.Deeper
- 2790 /Applications/Fluke.app
- 2791 - com.kichenko.fluke
- 2792 /Applications/FreeMind.app
- 2793 - freemind.main.FreeMind
- 2794 /Applications/Games/Analogue.app
- 2795 - org.renpy.launcher
- 2796 /Applications/Games/Angband/Angband.app
- 2797 - org.rephial.angband
- 2798 /Applications/Games/Angband/FAangband.app
- 2799 - N/A
- 2800 /Applications/Games/Aquaria.app
- 2801 - com.bit-blot.aquaria
- 2802 /Applications/Games/Avadon - The Black Fortress ƒ/Avadon v1.0.4.app
- 2803 - com.spiderwebsoftware.Avadon
- 2804 /Applications/Games/Avernum - Escape From the Pit (Full Version)/Avernum v1.0.2.app
- 2805 - com.spiderwebsoftware.Avernum
- 2806 /Applications/Games/Blades of Avernum ƒ/Blades of Avernum v1.2.1.app
- 2807 - com.SpiderwebSoftware.Blades of Avernum (Univ)
- 2808 /Applications/Games/Geneforge v1.2 ƒ/Geneforge v1.2.app
- 2809 - com.yourcompany.Geneforge_Univ
- 2810 /Applications/Games/Install Avadon (Full).app
- 2811 - com.MindVision.Installer
- 2812 /Applications/Games/LongLiveTheQueen.app
- 2813 - org.renpy.launcher
- 2814 /Applications/Games/Nethergate - Resurrection ƒ/Nethergate - Resurrection v1.0.3.app
- 2815 - com.SpiderwebSoftware.Nethergate
- 2816 /Applications/Games/hateplus_mac/Hate Plus.app
- 2817 - org.renpy.launcher
- 2818 /Applications/Games/hateplus_mac/game/hatoful.app
- 2819 - unity.Mediatonic.HatofulBoyfriend
- 2820 /Applications/Gas Mask.app
- 2821 - ee.clockwise.gmask
- 2822 /Applications/Get Lyrical.app
- 2823 - com.shullian.getlyrical
- 2824 /Applications/GoPanda2.app
- 2825 - com.intel.nw
- 2826 /Applications/HandBrake.app
- 2827 - fr.handbrake.HandBrake
- 2828 /Applications/Hemingway.app
- 2829 - com.node-webkit-builder.hemingway
- 2830 /Applications/Influent.app
- 2831 - unity.Three Flip Studios.Influent
- 2832 /Applications/Jubler.app
- 2833 - com.panayotis.jubler
- 2834 /Applications/Jutoh.app
- 2835 - uk.co.anthemion.jutoh
- 2836 /Applications/MP4Joiner.app
- 2837 - org.mp4joiner.MP4Joiner
- 2838 /Applications/Messenger.app
- 2839 - com.marcojetson.Messenger
- 2840 /Applications/Microsoft Office 2011/Office/Add-Ins/Solver.app
- 2841 - com.microsoft.ASApplication
- 2842 /Applications/Microsoft Office 2011/Office/Equation Editor.app
- 2843 - com.microsoft.EquationEditor
- 2844 /Applications/Microsoft Office 2011/Office/Microsoft Office Setup Assistant.app
- 2845 - com.microsoft.office.setupassistant
- 2846 /Applications/Microsoft Office 2011/Office/Microsoft Query.app
- 2847 - com.microsoft.Query
- 2848 /Applications/OnyX.app
- 2849 - com.titanium.OnyX
- 2850 /Applications/OpenDNS Updater.app
- 2851 - com.opendns.OpenDNS_Updater
- 2852 /Applications/OpenOffice.app
- 2853 - org.openoffice.script
- 2854 /Applications/OverDrive Media Console.app
- 2855 - com.overdrive.overdrivemediaconsole
- 2856 /Applications/Pandora.app
- 2857 - com.pandora.desktop.UUID.1
- 2858 /Applications/PhotoMill X.app
- 2859 - N/A
- 2860 /Applications/Proview.app
- 2861 - com.coherentpdf.proview
- 2862 /Applications/Python 2.7/Python Launcher.app
- 2863 - org.python.PythonLauncher
- 2864 /Applications/RDMPlusDesktop.app
- 2865 - com.shapeservices.rdm.rdmplusdesktopmac
- 2866 /Applications/Remote Desktop Connection.app
- 2867 - com.microsoft.rdc
- 2868 /Applications/SixtyFour.app
- 2869 - com.1951FDG.SixtyFour
- 2870 /Applications/SixtyFour.app/Contents/Applications/ProcessTimer.app
- 2871 - com.1951FDG.ProcessTimer
- 2872 /Applications/Skim.app
- 2873 - net.sourceforge.skim-app.skim
- 2874 /Applications/SlickVPN.app
- 2875 - org.pythonmac.unspecified.SlickVPN
- 2876 /Applications/Subler.app
- 2877 - org.galad.Subler
- 2878 /Applications/TeX/BibDesk.app
- 2879 - edu.ucsd.cs.mmccrack.bibdesk
- 2880 /Applications/TeX/Excalibur-4.0.7/Excalibur.app
- 2881 - edu.bucknell.Excalibur
- 2882 /Applications/TeX/LaTeXiT.app
- 2883 - fr.chachatelier.pierre.LaTeXiT
- 2884 /Applications/TeX/SimpleTeX4ht.app
- 2885 - N/A
- 2886 /Applications/TeX/TeX Live Utility.app
- 2887 - com.googlecode.mactlmgr.tlu
- 2888 /Applications/TeX/texmaker.app
- 2889 - texmaker
- 2890 /Applications/Text editing/Sigil.app
- 2891 - N/A
- 2892 /Applications/Tor Messenger.app
- 2893 - org.instantbird
- 2894 /Applications/TorBrowser.app
- 2895 - org.mozilla.tor browser
- 2896 /Applications/Utilities/Adobe AIR Application Installer.app
- 2897 - com.adobe.air.ApplicationInstaller
- 2898 /Applications/Utilities/Adobe AIR Uninstaller.app
- 2899 - com.adobe.air.Installer
- 2900 /Applications/Utilities/Stuffit Extras/Sample Droplets/Attach a ZIP archive to an email.app
- 2901 - com.stuffit.droplet.UUID
- 2902 /Applications/Utilities/Stuffit Extras/Sample Droplets/Attach an encrypted ZIP archive to an email.app
- 2903 - com.stuffit.droplet.UUID
- 2904 /Applications/Utilities/Stuffit Extras/Sample Droplets/Burn a StuffIt X archive to CD or DVD.app
- 2905 - com.stuffit.droplet.UUID
- 2906 /Applications/Utilities/Stuffit Extras/Sample Droplets/Create a DMG of files (no compression).app
- 2907 - com.stuffit.droplet.UUID
- 2908 /Applications/Utilities/Stuffit Extras/Sample Droplets/Create an encrypted ZIP archive and prompt for Destination.app
- 2909 - com.stuffit.droplet.UUID
- 2910 /Applications/Utilities/Stuffit Extras/Sample Droplets/Expand an archive - delete archive when done.app
- 2911 - com.stuffit.droplet.UUID
- 2912 /Applications/WeNotify.app
- 2913 - com.eurosmartz.macpushpublic
- 2914 /Applications/WePrint Server.app
- 2915 - com.eurosmartz.mobile.printserver
- 2916 /Applications/WhiteNoiseCreator.app
- 2917 - com.tmsoft.mac.WhiteNoiseCreator
- 2918 /Applications/XLD.app
- 2919 - jp.tmkk.XLD
- 2920 /Applications/cDock.app
- 2921 - org.w0lf.cDock-GUI
- 2922 /Applications/cocoaDialog.app
- 2923 - com.cocoaDialog
- 2924 /Applications/iFunBox.app
- 2925 - com.iFunBoxDevTeam.iFunBox
- 2926 /Applications/kid3.app
- 2927 - net.sourceforge.kid3
- 2928 /Applications/kurso4.app
- 2929 - com.yourcompany.kurso4
- 2930 /Applications/terminal-notifier.app
- 2931 - nl.superalloy.oss.terminal-notifier
- 2932 /Library/Application Support/Dragon/Speech Engine Data (English) 4.0.app
- 2933 - com.dragon.Speech_Engine_Data__English__4_0
- 2934 /Library/Application Support/Dragon/Speech Engine Data v3.app
- 2935 - com.dragon.Speech_Engine_Data_v3
- 2936 /Library/Application Support/Microsoft/MERP2.0/Microsoft Error Reporting.app
- 2937 - com.microsoft.error_reporting
- 2938 /Library/Application Support/Microsoft/MERP2.0/Microsoft Ship Asserts.app
- 2939 - com.microsoft.netlib.shipassertprocess
- 2940 /Library/Application Support/Microsoft/Silverlight/OutOfBrowser/SLLauncher.app
- 2941 - com.microsoft.silverlight.sllauncher
- 2942 /Library/Application Support/iGlasses3/iGlasses.app
- 2943 - com.ecamm.iGlassesAgent
- 2944 /Library/Frameworks/Adobe AIR.framework/Versions/1.0/Adobe AIR Application Installer.app
- 2945 - com.adobe.air.ApplicationInstaller
- 2946 /Library/Frameworks/Adobe AIR.framework/Versions/1.0/Resources/Adobe AIR Updater.app
- 2947 - com.adobe.air.Installer
- 2948 /Library/Frameworks/Tk.framework/Versions/8.6/Resources/Wish.app
- 2949 - com.tcltk.wish
- 2950 /Library/Ruby/Gems/2.0.0/gems/terminal-notifier-1.6.2/vendor/terminal-notifier/terminal-notifier.app
- 2951 - nl.superalloy.oss.terminal-notifier
- 2952 /Library/Ruby/Gems/2.0.0/gems/terminal-notifier-1.6.3/vendor/terminal-notifier/terminal-notifier.app
- 2953 - nl.superalloy.oss.terminal-notifier
- 2954 /Library/Services/GPGServices.service
- 2955 - org.gpgtools.gpgservices
- 2956 /Users/USER/Applications/Chrome Apps.localized/Profile 1 apdfllckaahabafndbhieahigkjlhalf.app
- 2957 - com.google.Chrome.app.Profile-1-apdfllckaahabafndbhieahigkjlhalf
- 2958 /Users/USER/Applications/Chrome Apps.localized/Profile 1 blpcfgokakmgnkcojhhkbfbldkacnbeo.app
- 2959 - com.google.Chrome.app.Profile-1-blpcfgokakmgnkcojhhkbfbldkacnbeo
- 2960 /Users/USER/Applications/Chrome Apps.localized/Profile 1 coobgpohoikkiipiblmjeljniedjpjpf.app
- 2961 - com.google.Chrome.app.Profile-1-coobgpohoikkiipiblmjeljniedjpjpf
- 2962 /Users/USER/Applications/Chrome Apps.localized/Profile 1 kcfoblhpibkgaolddkdakldhfpjfjgod.app
- 2963 - com.google.Chrome.app.Profile-1-kcfoblhpibkgaolddkdakldhfpjfjgod
- 2964 /Users/USER/Applications/Chrome Apps.localized/Profile 1 pjkljhegncpnkpknbcohdijeoejaedia.app
- 2965 - com.google.Chrome.app.Profile-1-pjkljhegncpnkpknbcohdijeoejaedia
- 2966 /Users/USER/Applications/CrossOver/CrossOver Explorer.app
- 2967 - com.codeweavers.CrossOverHelper.UUID.UUID
- 2968 /Users/USER/Applications/CrossOver/My Girlfriend is the President/My Girlfriend is the President on the Web.app
- 2969 - com.codeweavers.CrossOverHelper.UUID.UUID
- 2970 /Users/USER/Applications/CrossOver/My Girlfriend is the President/My Girlfriend is the President.app
- 2971 - com.codeweavers.CrossOverHelper.UUID.UUID
- 2972 /Users/USER/Applications/CrossOver/My Girlfriend is the President/Uninstall My Girlfriend is the President.app
- 2973 - com.codeweavers.CrossOverHelper.UUID.UUID
- 2974 /Users/USER/Applications/Seduce Me.app
- 2975 - unity.No Reply Games.Seduce Me
- 2976 /Users/USER/Downloads/SIMBL-0.9.9/SIMBL Uninstaller.app
- 2977 - org.mike.SIMBLUninstaller
- 2978 /Users/USER/Downloads/mmd-drag/MMD2HTML.app
- 2979 - net.fletcherpenney.MMD2HTML
- 2980 /Users/USER/Downloads/mmd-drag/MMD2LaTeX.app
- 2981 - net.fletcherpenney.MMD2LaTeX
- 2982 /Users/USER/Downloads/mmd-drag/MMD2ODF.app
- 2983 - net.fletcherpenney.MMD2ODF
- 2984 /Users/USER/Downloads/mmd-drag/MMD2PDF.app
- 2985 - net.fletcherpenney.MMD2PDF
- 2986 /Users/USER/Downloads/mmd-drag/MMD2RTF.app
- 2987 - net.fletcherpenney.MMD2RTF
- 2988 /Users/USER/Dropbox/Alfred/Alfred.alfredpreferences/workflows/user.workflow.UUID/resources/DummyAppForGrowl.app
- 2989 - N/A
- 2990 /Users/USER/Library/Application Support/CrossOver/Helpers/CrossOver Helper (CrossOver HTML engine (IE 8.0 mode)).app
- 2991 - com.codeweavers.CrossOverHelper.CrossOverUUID/
- 2992 /Users/USER/Library/Application Support/Eltima Software/Folx3/FolxAgent.app
- 2993 - com.eltima.FolxAgent
- 2994 /Users/USER/Library/Application Support/Facebook/video/1.2.0.158/FacebookVideoCalling.app
- 2995 - com.Skype.FacebookVideoCalling
- 2996 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_aohghmighlieiainnegkcijnfilokake/Default aohghmighlieiainnegkcijnfilokake.app
- 2997 - com.google.Chrome.app.Default-aohghmighlieiainnegkcijnfilokake-internal
- 2998 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_apdfllckaahabafndbhieahigkjlhalf/Default apdfllckaahabafndbhieahigkjlhalf.app
- 2999 - com.google.Chrome.app.Default-apdfllckaahabafndbhieahigkjlhalf-internal
- 3000 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_blpcfgokakmgnkcojhhkbfbldkacnbeo/Default blpcfgokakmgnkcojhhkbfbldkacnbeo.app
- 3001 - com.google.Chrome.app.Default-blpcfgokakmgnkcojhhkbfbldkacnbeo-internal
- 3002 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_coobgpohoikkiipiblmjeljniedjpjpf/Default coobgpohoikkiipiblmjeljniedjpjpf.app
- 3003 - com.google.Chrome.app.Default-coobgpohoikkiipiblmjeljniedjpjpf-internal
- 3004 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_ejjicmeblgpmajnghnpcppodonldlgfn/Default ejjicmeblgpmajnghnpcppodonldlgfn.app
- 3005 - com.google.Chrome.app.Default-ejjicmeblgpmajnghnpcppodonldlgfn-internal
- 3006 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_fkkaebihfmbofclegkcfkkemepfehibg/Default fkkaebihfmbofclegkcfkkemepfehibg.app
- 3007 - com.google.Chrome.app.Default-fkkaebihfmbofclegkcfkkemepfehibg-internal
- 3008 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_hbdpomandigafcibbmofojjchbcdagbl/Default hbdpomandigafcibbmofojjchbcdagbl.app
- 3009 - com.google.Chrome.app.Default-hbdpomandigafcibbmofojjchbcdagbl-internal
- 3010 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_icmaknaampgiegkcjlimdiidlhopknpk/Default icmaknaampgiegkcjlimdiidlhopknpk.app
- 3011 - com.google.Chrome.app.Default-icmaknaampgiegkcjlimdiidlhopknpk-internal
- 3012 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_ioekoebejdcmnlefjiknokhhafglcjdl/Default ioekoebejdcmnlefjiknokhhafglcjdl.app
- 3013 - com.google.Chrome.app.Default-ioekoebejdcmnlefjiknokhhafglcjdl-internal
- 3014 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_lneaknkopdijkpnocmklfnjbeapigfbh/Default lneaknkopdijkpnocmklfnjbeapigfbh.app
- 3015 - com.google.Chrome.app.Default-lneaknkopdijkpnocmklfnjbeapigfbh-internal
- 3016 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_mmimngoggfoobjdlefbcabngfnmieonb/Default mmimngoggfoobjdlefbcabngfnmieonb.app
- 3017 - com.google.Chrome.app.Default-mmimngoggfoobjdlefbcabngfnmieonb-internal
- 3018 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_nmmhkkegccagdldgiimedpiccmgmieda/Default nmmhkkegccagdldgiimedpiccmgmieda.app
- 3019 - com.google.Chrome.app.Default-nmmhkkegccagdldgiimedpiccmgmieda-internal
- 3020 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_pdabfienifkbhoihedcgeogidfmibmhp/Default pdabfienifkbhoihedcgeogidfmibmhp.app
- 3021 - com.google.Chrome.app.Default-pdabfienifkbhoihedcgeogidfmibmhp-internal
- 3022 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_pjejbgheonogbpfkkjigbmahaljipoej/Default pjejbgheonogbpfkkjigbmahaljipoej.app
- 3023 - com.google.Chrome.app.Default-pjejbgheonogbpfkkjigbmahaljipoej-internal
- 3024 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_pjkljhegncpnkpknbcohdijeoejaedia/Default pjkljhegncpnkpknbcohdijeoejaedia.app
- 3025 - com.google.Chrome.app.Default-pjkljhegncpnkpknbcohdijeoejaedia-internal
- 3026 /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_aohghmighlieiainnegkcijnfilokake/Profile 1 aohghmighlieiainnegkcijnfilokake.app
- 3027 - com.google.Chrome.app.Profile-1-aohghmighlieiainnegkcijnfilokake-internal
- 3028 /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_apdfllckaahabafndbhieahigkjlhalf/Profile 1 apdfllckaahabafndbhieahigkjlhalf.app
- 3029 - com.google.Chrome.app.Profile-1-apdfllckaahabafndbhieahigkjlhalf-internal
- 3030 /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_blpcfgokakmgnkcojhhkbfbldkacnbeo/Profile 1 blpcfgokakmgnkcojhhkbfbldkacnbeo.app
- 3031 - com.google.Chrome.app.Profile-1-blpcfgokakmgnkcojhhkbfbldkacnbeo-internal
- 3032 /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_coobgpohoikkiipiblmjeljniedjpjpf/Profile 1 coobgpohoikkiipiblmjeljniedjpjpf.app
- 3033 - com.google.Chrome.app.Profile-1-coobgpohoikkiipiblmjeljniedjpjpf-internal
- 3034 /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_kcfoblhpibkgaolddkdakldhfpjfjgod/Profile 1 kcfoblhpibkgaolddkdakldhfpjfjgod.app
- 3035 - com.google.Chrome.app.Profile-1-kcfoblhpibkgaolddkdakldhfpjfjgod-internal
- 3036 /Users/USER/Library/Application Support/Google/Chrome/Profile 1/Web Applications/_crx_pjkljhegncpnkpknbcohdijeoejaedia/Profile 1 pjkljhegncpnkpknbcohdijeoejaedia.app
- 3037 - com.google.Chrome.app.Profile-1-pjkljhegncpnkpknbcohdijeoejaedia-internal
- 3038 /Users/USER/Library/Application Support/MountainNotifier/EggTimer.app
- 3039 - NOTIFIER.EggTimer
- 3040 /Users/USER/Library/Application Support/MountainNotifier/MountainNotifierTemplate.app
- 3041 - info.pich.MountainNotifierTemplate
- 3042 /Users/USER/Library/Application Support/Steam/SteamApps/common/AI War Fleet Command/AIWar.app
- 3043 - unity.Arcen Games, LLC.AI War
- 3044 /Users/USER/Library/Application Support/Steam/SteamApps/common/AI War Fleet Command/UDA/ArcenUpdater.app
- 3045 - unity.Arcen Games, LLC.Arcen Updater
- 3046 /Users/USER/Library/Application Support/Steam/SteamApps/common/Bientot_l_ete/Bientôt l’été.app:̂t l’été:
- 3047 - N/A
- 3048 /Users/USER/Library/Application Support/Steam/SteamApps/common/Duke Nukem 3D/bin/build.app
- 3049 - au.id.jonof.kenbuild.build
- 3050 /Users/USER/Library/Application Support/Steam/SteamApps/common/Duke Nukem 3D/bin/duke3d.app
- 3051 - com.generalarcade.duke3d
- 3052 /Users/USER/Library/Application Support/Steam/SteamApps/common/GoatSimulator/GoatSimulator.app
- 3053 - com.coffeestainstudios.goatsimulator
- 3054 /Users/USER/Library/Application Support/Steam/SteamApps/common/Hacker Evolution Duality/HackerEvolutionDuality.app
- 3055 - com.exosyphen.heddeluxe
- 3056 /Users/USER/Library/Application Support/Steam/SteamApps/common/Shadow Warrior Classic/bin/build.app
- 3057 - au.id.jonof.kenbuild.build
- 3058 /Users/USER/Library/Application Support/Steam/SteamApps/common/Shadow Warrior Classic/bin/sw.app
- 3059 - com.generalarcade.sw
- 3060 /Users/USER/Library/Mail/Bundles (Disabled 11)/DockStar.mailbundle/Contents/Resources/Software Update.app
- 3061 - com.creativeinaustria.DockStar.SoftwareUpdate
- 3062 /Users/USER/Library/Mobile Documents/com~apple~Automator/Documents/Untitled 2.app
- 3063 - com.apple.automator.Untitled 2
- 3064 /Users/USER/Library/Mobile Documents/com~apple~Automator/Documents/Untitled.app
- 3065 - com.apple.automator.Untitled
- 3066 /Users/USER/Library/Printers/Officejet Pro 8500 A910 [D0C9AB].app
- 3067 - com.apple.print.PrinterProxy
- 3068 /Users/USER/Library/Services/CalcService.service
- 3069 - org.grunenberg.CalcService
- 3070 /Users/USER/Library/Services/NoteBookHelper.service
- 3071 - com.CircusPonies.NoteBookHelper
- 3072 /Users/USER/Library/Services/OmniOutliner Professional.service
- 3073 - com.omnigroup.OmniOutlinerPro3.ClippingService
- 3074 /Users/USER/Library/Workflows/Applications/Calendar/Sickbeard MP4 Automation (scheduled).app
- 3075 - com.apple.automator.Sickbeard MP4 Automation (scheduled)
- 3076 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_aohghmighlieiainnegkcijnfilokake/Default aohghmighlieiainnegkcijnfilokake.app
- 3077 - com.google.Chrome.app.Default-aohghmighlieiainnegkcijnfilokake-internal
- 3078 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_nmmhkkegccagdldgiimedpiccmgmieda/Default nmmhkkegccagdldgiimedpiccmgmieda.app
- 3079 - com.google.Chrome.app.Default-nmmhkkegccagdldgiimedpiccmgmieda-internal
- 3080 /Users/USER/Library/Mobile Documents/com~apple~Automator/Documents/Untitled 2.app
- 3081 - com.apple.automator.Untitled 2
- 3082 /Users/USER/Library/Mobile Documents/com~apple~Automator/Documents/Untitled.app
- 3083 - com.apple.automator.Untitled
- 3084 /Users/USER/Applications/Chrome Apps.localized/Default coobgpohoikkiipiblmjeljniedjpjpf.app
- 3085 - com.google.Chrome.app.Default-coobgpohoikkiipiblmjeljniedjpjpf
- 3086 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_blpcfgokakmgnkcojhhkbfbldkacnbeo/Default blpcfgokakmgnkcojhhkbfbldkacnbeo.app
- 3087 - com.google.Chrome.app.Default-blpcfgokakmgnkcojhhkbfbldkacnbeo-internal
- 3088 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_coobgpohoikkiipiblmjeljniedjpjpf/Default coobgpohoikkiipiblmjeljniedjpjpf.app
- 3089 - com.google.Chrome.app.Default-coobgpohoikkiipiblmjeljniedjpjpf-internal
- 3090 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_nmmhkkegccagdldgiimedpiccmgmieda/Default nmmhkkegccagdldgiimedpiccmgmieda.app
- 3091 - com.google.Chrome.app.Default-nmmhkkegccagdldgiimedpiccmgmieda-internal
- 3092 /Users/USER/Library/Application Support/Google/Chrome/Default/Web Applications/_crx_pjkljhegncpnkpknbcohdijeoejaedia/Default pjkljhegncpnkpknbcohdijeoejaedia.app
- 3093 - com.google.Chrome.app.Default-pjkljhegncpnkpknbcohdijeoejaedia-internal
- 3094 /usr/local/Cellar/python/2.7.10_2/Frameworks/Python.framework/Versions/2.7/Resources/Python.app
- 3095 - org.python.python
- 3096 /usr/local/Cellar/python/2.7.10_2/Python Launcher.app
- 3097 - org.python.PythonLauncher
- 3098 /usr/local/Cellar/terminal-notifier/1.6.3/terminal-notifier.app
- 3099 - nl.superalloy.oss.terminal-notifier
- 3100 /usr/local/git/share/git-gui/lib/Git Gui.app
- 3101 - cz.or.repo.git-gui
- 3102
- 3103 Frameworks
- 3104
- 3105 /Library/Frameworks/Adobe AIR.framework
- 3106 - com.adobe.AIR
- 3107 /Library/Frameworks/IntegoiCalFramework.framework
- 3108 - N/A
- 3109 /Library/Frameworks/Libmacgpg.framework
- 3110 - org.gpgtools.Libmacgpg
- 3111 /Library/Frameworks/MacFUSE.framework
- 3112 - com.google.MacFUSE
- 3113 /Library/Frameworks/Mono.framework
- 3114 - N/A
- 3115 /Library/Frameworks/NetUpdateShared.framework
- 3116 - com.intego.NetUpdateShared
- 3117 /Library/Frameworks/OSXFUSE.framework
- 3118 - com.github.osxfuse.framework
- 3119 /Library/Frameworks/Tcl.framework
- 3120 - com.tcltk.tcllibrary
- 3121 /Library/Frameworks/Tk.framework
- 3122 - com.tcltk.tklibrary
- 3123 /Users/USER/Library/Frameworks/EWSMac.framework
- 3124 - com.eSellerate.EWSMac83886081
- 3125
- 3126 PrefPane
- 3127
- 3128 /Library/Internet Plug-Ins/JavaAppletPlugin.plugin/Contents/Home/lib/deploy/JavaControlPanel.prefPane
- 3129 - com.oracle.java.JavaControlPanel
- 3130 /Library/PreferencePanes/Flash Player.prefPane
- 3131 - com.adobe.flashplayerpreferences
- 3132 /Library/PreferencePanes/Hazel.prefPane
- 3133 - com.noodlesoft.Hazel
- 3134 /Library/PreferencePanes/LocalTeX.prefPane
- 3135 - com.eugenealgorithms.LocalTeX
- 3136 /Library/PreferencePanes/OSXFUSE.prefPane
- 3137 - com.github.osxfuse.OSXFUSEPrefPane
- 3138 /Library/PreferencePanes/ParagonNTFS.prefPane:® OS X:
- 3139 - N/A
- 3140 /Library/PreferencePanes/RedHand.prefPane
- 3141 - com.soma-zone.RedHandPreferences
- 3142 /Library/PreferencePanes/Screens Connect.prefPane
- 3143 - com.edovia.screens.connect.mac
- 3144 /Library/PreferencePanes/Spelling.prefPane
- 3145 - net.leuski.cocoaspell.Spelling
- 3146 /Library/PreferencePanes/TeXDistPrefPane.prefPane
- 3147 - comp.text.tex.distribution.preference
- 3148 /Library/PreferencePanes/Witch.prefPane
- 3149 - com.manytricks.Witch
- 3150 /Users/USER/Library/PreferencePanes/Default Folder X.prefPane
- 3151 - com.stclairsoft.prefpane.DefaultFolderX
- 3152 /Users/USER/Library/PreferencePanes/GPGPreferences.prefPane
- 3153 - org.gpgtools.gpgpreferences
- 3154 /Users/USER/Library/PreferencePanes/MusicManager.prefPane
- 3155 - com.google.musicmanager.pref
- 3156 /Users/USER/Library/PreferencePanes/Printopia.prefPane
- 3157 - com.ecamm.printopia
- 3158
- 3159 Bundles
- 3160
- 3161 /Library/Audio/Plug-Ins/HAL/BartenderAudioPlugIn.plugin
- 3162 - com.surteesstudios.BartenderAudioPlugIn
- 3163 /Library/CoreMediaIO/Plug-Ins/DAL/iGlasses.plugin
- 3164 - com.ecamm.iGlasses3
- 3165 /Library/CoreMediaIO/Plug-Ins/FCP-DAL/iGlasses.plugin
- 3166 - com.ecamm.iGlasses3
- 3167 /Library/Frameworks/Adobe AIR.framework/Versions/1.0/Resources/AdobeCP15.plugin
- 3168 - com.adobe.adobecp
- 3169 /Library/Frameworks/Adobe AIR.framework/Versions/1.0/Resources/Flash Player.plugin
- 3170 - com.macromedia.FlashPlayer-10.6.plugin
- 3171 /Library/Internet Plug-Ins/Flash Player.plugin
- 3172 - com.macromedia.Flash Player.plugin
- 3173 /Library/Internet Plug-Ins/JavaAppletPlugin.plugin
- 3174 - com.oracle.java.JavaAppletPlugin
- 3175 /Library/Internet Plug-Ins/MeetingJoinPlugin.plugin
- 3176 - com.microsoft.communicator.meetingjoinplugin
- 3177 /Library/Internet Plug-Ins/SharePointBrowserPlugin.plugin
- 3178 - com.microsoft.sharepoint.browserplugin
- 3179 /Library/Internet Plug-Ins/Silverlight.plugin
- 3180 - com.microsoft.SilverlightPlugin
- 3181 /Library/Internet Plug-Ins/googletalkbrowserplugin.plugin
- 3182 - com.google.googletalkbrowserplugin
- 3183 /Library/Internet Plug-Ins/npDDRia.plugin
- 3184 - com.nuance.npDDRia
- 3185 /Library/Internet Plug-Ins/o1dbrowserplugin.plugin
- 3186 - com.google.o1dbrowserplugin
- 3187 /Library/Mail/Bundles/GPGMail.mailbundle
- 3188 - org.gpgtools.gpgmail
- 3189 /Library/QuickLook/FreemindQL.qlgenerator
- 3190 - net.freemind.qlgenerator
- 3191 /Library/Screen Savers/Electric Sheep.saver
- 3192 - org.electricsheep.ElectricSheep.saver
- 3193 /Library/Spotlight/Wolfram Notebook.mdimporter
- 3194 - com.wolfram.mathematica.notebook.search.spotlight
- 3195 /Library/Tundra/Plug-Ins/DAL/iGlasses3.plugin
- 3196 - com.ecamm.iGlasses3
- 3197 /Users/USER/Downloads/MacTeXtras/Extras/Browsers/Symbols.wdgt
- 3198 - com.vocaro.widget.Symbols
- 3199 /Users/USER/Downloads/MultiMarkdown QuickLook Generator/MultiMarkdownQuickLook.qlgenerator
- 3200 - net.fletcherpenney.quicklook
- 3201 /Users/USER/Library/Address Book Plug-Ins/DeskConnect Plug-In.bundle
- 3202 - com.deskconnect.address-book-plugin
- 3203 /Users/USER/Library/Address Book Plug-Ins/SkypeABCaller.bundle
- 3204 - com.skype.SkypeABCaller
- 3205 /Users/USER/Library/Address Book Plug-Ins/SkypeABChatter.bundle
- 3206 - com.skype.SkypeABChatter
- 3207 /Users/USER/Library/Address Book Plug-Ins/SkypeABDialer.bundle
- 3208 - com.skype.skypeabdialer
- 3209 /Users/USER/Library/Address Book Plug-Ins/SkypeABSMS.bundle
- 3210 - com.skype.skypeabsms
- 3211 /Users/USER/Library/Application Support/Eltima Software/Folx3/Folx3Plugin.plugin
- 3212 - com.eltima.Folx3.plugin
- 3213 /Users/USER/Library/Application Support/Google/Chrome/PepperFlash/19.0.0.226/PepperFlashPlayer.plugin
- 3214 - com.macromedia.PepperFlashPlayer.pepper
- 3215 /Users/USER/Library/Internet Plug-Ins/Box Edit.plugin
- 3216 - com.BoxEditLib.Box Edit
- 3217 /Users/USER/Library/Internet Plug-Ins/CitrixOnlineWebDeploymentPlugin.plugin
- 3218 - com.citrixonline.mac.WebDeploymentPlugin
- 3219 /Users/USER/Library/Spotlight/EndNote.mdimporter
- 3220 - com.ThomsonResearchSoft.EndNote
- 3221 /Users/USER/Library/Spotlight/NoteBook.mdimporter
- 3222 - com.CircusPonies.NoteBook.mdimporter
- 3223 /Users/USER/Library/Address Book Plug-Ins/SkypeABDialer.bundle
- 3224 - com.skype.skypeabdialer
- 3225 /Users/USER/Library/Address Book Plug-Ins/SkypeABSMS.bundle
- 3226 - com.skype.skypeabsms
- 3227 /Users/USER/Library/Application Support/Google/Chrome/PepperFlash/11.8.800.97/PepperFlashPlayer.plugin
- 3228 - com.macromedia.PepperFlashPlayer.pepper
- 3229 /Users/USER/Library/Address Book Plug-Ins/SkypeABCaller.bundle
- 3230 - com.skype.SkypeABCaller
- 3231 /Users/USER/Library/Address Book Plug-Ins/SkypeABChatter.bundle
- 3232 - com.skype.SkypeABChatter
- 3233 /Users/USER/Library/Address Book Plug-Ins/SkypeABDialer.bundle
- 3234 - com.skype.skypeabdialer
- 3235 /Users/USER/Library/Address Book Plug-Ins/SkypeABSMS.bundle
- 3236 - com.skype.skypeabsms
- 3237 /Users/USER/Library/Application Support/Google/Chrome/PepperFlash/19.0.0.226/PepperFlashPlayer.plugin
- 3238 - com.macromedia.PepperFlashPlayer.pepper
- 3239
- 3240 App extensions
- 3241
- 3242 com.HobbyistSoftware.RightClick.RCPlugin
- 3243 com.Monity.Widget
- 3244 com.agilebits.onepassword-osx.safariextensioncompanion
- 3245 com.crowdedroad.ifaxpromac.widget
- 3246 com.dayoneapp.dayone.Day-One-Share-Extension
- 3247 com.devon-technologies.think.share
- 3248 com.flexibits.fantastical2.mac.action-extension
- 3249 com.flexibits.fantastical2.mac.share-extension
- 3250 com.flexibits.fantastical2.mac.today-widget
- 3251 com.junecloud.mac.Deliveries.Add
- 3252 com.junecloud.mac.Deliveries.Today
- 3253 com.kachalobalashoff.iStudiez.Today
- 3254 com.lifewareSolutions.DeluxeMoonProForMac.DeluxeMoonWidget
- 3255 com.microsoft.onenote.mac.shareextension
- 3256 com.pushbullet.macapp.Pushbullet-Share
- 3257 com.readitlater.PocketMac.AddToPocketShareExtension
- 3258 com.todoist.mac.Todoist.TodoistShare
- 3259 com.todoist.mac.Todoist.TodoistToday
- 3260 io.github.norio-nomura.CopyLatLngOnMaps.ShareExtension
- 3261 it.bloop.airmail2.Airmail-Compose
- 3262 it.bloop.airmail2.Airmail-Share
- 3263 it.bloop.airmail2.Airmail-Today
- 3264
- 3265 Modifications
- 3266
- 3267 file added: /Applications/Adobe Digital Editions 4.0.app/Contents/MacOS/digitaleditions
- 3268 file added: /Applications/Amazon Music.app/Contents/Frameworks/Amazon Music Helper.app
- 3269 file added: /Applications/Amazon Music.app/Contents/Frameworks/cef/libcef.dylib
- 3270 file added: /Applications/AudioBookBinder.app/Contents/MacOS/abbinder
- 3271 file added: /Applications/AudioBookBinder.app/Contents/MacOS/AudioBookBinder.x86_64
- 3272 file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Formats/Molecular Ecology
- 3273 file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Formats/Annu Rev Neurosci
- 3274 file missing: /Applications/Bookends.app/Contents/Resources/Toolbar_List2Active.png
- 3275 file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/MIT
- 3276 file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/BibTeX
- 3277 file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/Glasgow U
- 3278 file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/Fordham U
- 3279 file missing: /Applications/Bookends.app/Contents/Resources/EMAIL
- 3280 file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/Library of Congress
- 3281 file missing: /Applications/Bookends.app/Contents/Resources/Support Files/Import Filters/Chinese U of Hong Kong
- 3282 ...
- 3283 file added: /Applications/DEVONsphere Express.app/Contents/MacOS/DEVONsphere Express.x86_64
- 3284 file added: /Applications/DiskMaker X.app/Contents/MacOS/applet.x86_64
- 3285 file modified: /Applications/DiskMaker X.app/Contents/Resources/Scripts/main.scpt
- 3286 file added: /Applications/EndNote X7/Services/ENService.app/Contents/MacOS/ENService.x86_64
- 3287 file added: /Applications/EndNote X7/Spell/Dictionary Converter.app/Contents/MacOS/Dictionary Converter.x86_64
- 3288 file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/da.lproj/preview.css
- 3289 file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/French.lproj/preview.css
- 3290 file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/pt.lproj/preview.css
- 3291 file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/pl.lproj/preview.css
- 3292 file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/es_MX.lproj/preview.css
- 3293 file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/fi.lproj/preview.css
- 3294 file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/cs.lproj/preview.css
- 3295 file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/sv.lproj/preview.css
- 3296 file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/ko.lproj/preview.css
- 3297 file missing: /Applications/GarageBand.app/Contents/Library/QuickLook/LogicXQLGenerator.qlgenerator/Contents/Resources/zh_TW.lproj/preview.css
- 3298 ...
- 3299 file missing: /Applications/HardwareGrowler.app/Contents/Resources/pt.lproj
- 3300 file added: /Applications/HyperPdf.1.1.3.app/Contents/MacOS/HyperPdf.x86_64
- 3301 file missing: /Applications/HyperPdf.1.1.3.app/Contents/Library/QuickLook/Skim.qlgenerator/Contents/Resources/zh_TW.lproj/InfoPlist.strings
- 3302 file modified: /Applications/iBooks.app/Contents/Resources/el.lproj/BKAppAboutPanel.strings
- 3303 file modified: /Applications/iBooks.app/Contents/Resources/el.lproj/Localizable.strings
- 3304 file modified: /Applications/iBooks.app/Contents/Resources/es_MX.lproj/MainMenu.strings
- 3305 file modified: /Applications/iBooks.app/Contents/Resources/fr.lproj/BKAdvancedPreferences.strings
- 3306 file modified: /Applications/iBooks.app/Contents/Resources/fr.lproj/BKGeneralPreferences.strings
- 3307 file modified: /Applications/iBooks.app/Contents/Resources/fr.lproj/BKParentalPreferences.strings
- 3308 file modified: /Applications/iBooks.app/Contents/Resources/fr.lproj/Localizable.strings
- 3309 file modified: /Applications/iBooks.app/Contents/Resources/id.lproj/BKGeneralPreferences.strings
- 3310 file modified: /Applications/iBooks.app/Contents/Resources/id.lproj/BKStorePreferences.strings
- 3311 file modified: /Applications/iBooks.app/Contents/Resources/id.lproj/MainMenu.strings
- 3312 ...
- 3313 file added: /Applications/Insights.app/Contents/Resources/oc_source.png
- 3314 file added: /Applications/Insights.app/Contents/Resources/statistical_review_of_world_energy_2011.xltx
- 3315 file missing: /Applications/Intego/Washing Machine.app/Contents/Resources/UTIList.plist
- 3316 file added: /Applications/iTerm.app/Contents/MacOS/iTerm.x86_64
- 3317 file added: /Applications/KeyboardCleanTool.app/Contents/MacOS/KeyboardCleanTool.x86_64
- 3318 file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote â Copy Link of Selected Note.lbaction/Contents/_CodeSignature/CodeDirectory
- 3319 file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote â Copy Link of Selected Note.lbaction/Contents/_CodeSignature/CodeRequirements
- 3320 file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote â Copy Link of Selected Note.lbaction/Contents/_CodeSignature/CodeResources
- 3321 file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote â Copy Link of Selected Note.lbaction/Contents/_CodeSignature/CodeSignature
- 3322 file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote â Copy Link of Selected Note.lbaction/Contents/Info.plist
- 3323 file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote â Copy Link of Selected Note.lbaction/Contents/Resources/de.lproj/InfoPlist.strings
- 3324 file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote â Copy Link of Selected Note.lbaction/Contents/Resources/en.lproj/InfoPlist.strings
- 3325 file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote â Copy Link of Selected Note.lbaction/Contents/Scripts/default.scpt
- 3326 file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote â New Note With File.lbaction/Contents/_CodeSignature/CodeDirectory
- 3327 file added: /Applications/LaunchBar.app/Contents/Resources/Actions/Evernote â New Note With File.lbaction/Contents/_CodeSignature/CodeRequirements
- 3328 ...
- 3329 file added: /Applications/MacJournal.app/Contents/MacOS/MacJournal.x86_64
- 3330 file modified: /Applications/Mail Plugin Manager.app/Contents/Resources/appcasts.plist
- 3331 file added: /Applications/MarsEdit.app/Contents/MacOS/MarsEdit.x86_64
- 3332 file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/ConsoleView.nib 1/classes.nib
- 3333 file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/ConsoleView.nib 1/info.nib
- 3334 file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/ConsoleView.nib 1/keyedobjects.nib
- 3335 file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/IconView.nib 1/classes.nib
- 3336 file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/IconView.nib 1/info.nib
- 3337 file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/IconView.nib 1/keyedobjects.nib
- 3338 file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/MainMenu.nib 1/classes.nib
- 3339 file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/MainMenu.nib 1/info.nib
- 3340 file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/MainMenu.nib 1/keyedobjects.nib
- 3341 file added: /Applications/OverDrive Media Console.app/Contents/Resources/English.lproj/Thumbnail.nib 1/classes.nib
- 3342 ...
- 3343 file added: /Applications/Paperless.app/Contents/MacOS/Paperless.x86_64
- 3344 file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/Code/__init__.py
- 3345 file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/DefaultPrefs.json
- 3346 file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/Info.plist
- 3347 file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/Resources/attribution.png
- 3348 file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/Resources/icon-default.png
- 3349 file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/Contents/VERSION
- 3350 file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Fanart-TV.bundle/README.md
- 3351 file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Framework.bundle/.gitignore
- 3352 file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Framework.bundle/Contents/Info.plist
- 3353 file added: /Applications/Plex Media Server.app/Contents/Resources/Plug-ins-4ccd2ca/Framework.bundle/Contents/Resources/icon-default.png
- 3354 ...
- 3355 file added: /Applications/RunePDF.app/Contents/MacOS/RunePDF.x86_64
- 3356 file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/__pycache__/__init__.cpython-34.pyc
- 3357 file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/__pycache__/dammit.cpython-34.pyc
- 3358 file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/__pycache__/element.cpython-34.pyc
- 3359 file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/builder/__pycache__/__init__.cpython-34.pyc
- 3360 file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/builder/__pycache__/_html5lib.cpython-34.pyc
- 3361 file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/builder/__pycache__/_htmlparser.cpython-34.pyc
- 3362 file added: /Applications/Sigil.app/Contents/plugin_launchers/python/sigil_bs4/builder/__pycache__/_lxml.cpython-34.pyc
- 3363 file added: /Applications/Sigil.app/Contents/python3lib/__pycache__/opf_newparser.cpython-34.pyc
- 3364 file added: /Applications/Sigil.app/Contents/python3lib/__pycache__/xmlprocessor.cpython-34.pyc
- 3365 file added: /Applications/Splashtop Personal.app/Contents/MacOS/Splashtop Personal.x86_64
- 3366 file added: /Applications/StoryMill.app/Contents/MacOS/StoryMill.x86_64
- 3367 file added: /Applications/Themes for iBooks Author.app/Contents/MacOS/Themes for iBooks Author.x86_64
- 3368 file missing: /Applications/TinderboxSix.app/Contents/Resources/Tinderbox Six Help/help/elements/ContainerTitle.jpg
- 3369 file missing: /Applications/TinderboxSix.app/Contents/Resources/color schemes/Shades of Red/Shades of Red.tbc
- 3370 file missing: /Applications/TinderboxSix.app/Contents/Resources/Tinderbox Six Help/help/basic_concepts/prototypes.html
- 3371 file missing: /Applications/TinderboxSix.app/Contents/Resources/Tinderbox5Help/elements/Timelineviews.html
- 3372 file missing: /Applications/TinderboxSix.app/Contents/Resources/config/RSSChannel
- 3373 file missing: /Applications/TinderboxSix.app/Contents/Resources/Tinderbox Six Help/help/elements/ParkingSpace.jpg
- 3374 file missing: /Applications/TinderboxSix.app/Contents/Resources/badges/Symbols/moon.png
- 3375 file missing: /Applications/TinderboxSix.app/Contents/Resources/Tinderbox Six Help/help/release_notes/6_1_0.html
- 3376 file missing: /Applications/TinderboxSix.app/Contents/Resources/TbxURLInfoController.nib
- 3377 file missing: /Applications/TinderboxSix.app/Contents/Resources/badges/Symbols/laptop.png
- 3378 ...
- 3379 file added: /Applications/VLC.app/Contents/MacOS/plugins/plugins.dat
- 3380 file added: /Applications/VLC.app/Contents/MacOS/share/lua/extensions/140694-tvdb.lua
- 3381 file added: /Applications/VLC.app/Contents/MacOS/share/lua/extensions/140695-imdb.lua
- 3382 file added: /Applications/VLC.app/Contents/MacOS/share/lua/extensions/140697-tmdb.lua
- 3383 file added: /Applications/WeNotify.app/Contents/Resources/finishArchive.sh
- 3384
- 3385 Bad kernel extensions
- 3386
- 3387 /System/Library/Extensions/AppleOSXUSBNCM.kext
- 3388
- 3389 Installations
- 3390
- 3391 Day One: 11/13/15, 4:27 AM
- 3392 Electric Sheep 2.7b36: 11/13/15, 3:05 AM
- 3393 Monity: 11/12/15, 10:07 PM
- 3394 VirusBarrierDefinitions: 11/12/15, 10:05 AM
- 3395 ActiveState ActiveTcl 8.6.4.1.299124: 11/11/15, 7:42 AM
- 3396
- 3397 Elapsed time (sec): 42302
RAW Paste Data


